share

H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-ILE-ALA-THR-VAL-ILE-VAL-OH CAS NO 285554-31-6


Unit Price:

CAS No.:285554-31-6

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-ILE-ALA-THR-VAL-ILE-VAL-OH is a synthetic peptide of significant interest in advanced biomedical research and development. This compound is valued for its potential role in studying complex biological pathways and protein-protein interactions. It is primarily utilized by research institutions and pharmaceutical companies engaged in peptide-based drug discovery, vaccine development, and biochemical assay design.

Application

  • Biomedical Research: Used as a critical reagent in studying specific enzymatic activities, receptor binding, and signal transduction mechanisms.
  • Drug Discovery & Development: Serves as a lead compound or a key intermediate in the design and screening of novel peptide therapeutics.
  • Diagnostic Assay Development: Employed in the development of immunoassays and biosensors for detecting specific biomarkers or pathogens.
  • Biochemical & Structural Studies: Utilized for protein folding studies, epitope mapping, and understanding molecular recognition events.
  • Vaccine Research: Investigated as a potential antigen or immunogen component in next-generation vaccine platforms.

Basic Information

Product Name H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-ILE-ALA-THR-VAL-ILE-VAL-OH
CAS No. 285554-31-6
Molecular Formula C212H334N62O68S
Molecular Weight 4815.3 g/mol (approx.)
Synonyms Peptide CAS 285554-31-6; Synthetic 44-mer Peptide; Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr-Val-Ile-Val; H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr-Val-Ile-Val-OH; DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAVTIV-OH
EINECS Contact for details

Quality Control

Our peptide products are manufactured under strict quality management systems. Each batch of H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-ILE-ALA-THR-VAL-ILE-VAL-OH undergoes comprehensive analytical testing, including HPLC for purity and MS for identity confirmation, to ensure it meets the high standards required for research applications. Certificates of Analysis (COA) detailing purity, peptide content, and analytical data are provided with every shipment.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below in a dry environment. For long-term storage, lyophilized powder is recommended. This product is hygroscopic (moisture-sensitive). Allow the vial to reach room temperature before opening to minimize moisture absorption.

Specification

Item Specification
Appearance White to off-white lyophilized powder
Identification (HPLC/MS) Conforms to reference standard
Purity (HPLC) ≥ 95%
Peptide Content ≥ 80% (by weight)
Single Impurity (HPLC) ≤ 1.0%
Water Content (KF) ≤ 5.0%
Acetate Content (HPIC) ≤ 10.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.