

share
H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-ILE-ALA-THR-VAL-ILE-VAL-OH CAS NO 285554-31-6
Unit Price:
CAS No.:285554-31-6
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-ILE-ALA-THR-VAL-ILE-VAL-OH is a synthetic peptide of significant interest in advanced biomedical research and development. This compound is valued for its potential role in studying complex biological pathways and protein-protein interactions. It is primarily utilized by research institutions and pharmaceutical companies engaged in peptide-based drug discovery, vaccine development, and biochemical assay design.
Application
- Biomedical Research: Used as a critical reagent in studying specific enzymatic activities, receptor binding, and signal transduction mechanisms.
- Drug Discovery & Development: Serves as a lead compound or a key intermediate in the design and screening of novel peptide therapeutics.
- Diagnostic Assay Development: Employed in the development of immunoassays and biosensors for detecting specific biomarkers or pathogens.
- Biochemical & Structural Studies: Utilized for protein folding studies, epitope mapping, and understanding molecular recognition events.
- Vaccine Research: Investigated as a potential antigen or immunogen component in next-generation vaccine platforms.
Basic Information
| Product Name | H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-ILE-ALA-THR-VAL-ILE-VAL-OH |
| CAS No. | 285554-31-6 |
| Molecular Formula | C212H334N62O68S |
| Molecular Weight | 4815.3 g/mol (approx.) |
| Synonyms | Peptide CAS 285554-31-6; Synthetic 44-mer Peptide; Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr-Val-Ile-Val; H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr-Val-Ile-Val-OH; DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAVTIV-OH |
| EINECS | Contact for details |
Quality Control
Our peptide products are manufactured under strict quality management systems. Each batch of H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-ILE-ALA-THR-VAL-ILE-VAL-OH undergoes comprehensive analytical testing, including HPLC for purity and MS for identity confirmation, to ensure it meets the high standards required for research applications. Certificates of Analysis (COA) detailing purity, peptide content, and analytical data are provided with every shipment.
Storage
Preserve in a tightly closed container, protected from light. Store at -20°C or below in a dry environment. For long-term storage, lyophilized powder is recommended. This product is hygroscopic (moisture-sensitive). Allow the vial to reach room temperature before opening to minimize moisture absorption.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC/MS) | Conforms to reference standard |
| Purity (HPLC) | ≥ 95% |
| Peptide Content | ≥ 80% (by weight) |
| Single Impurity (HPLC) | ≤ 1.0% |
| Water Content (KF) | ≤ 5.0% |
| Acetate Content (HPIC) | ≤ 10.0% |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


L-Arginine, L-asparaginyl-L-α-glutamyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-valyl-L-prolyl-L-α-aspartyl-L-threonyl-L-lysyl-L-valyl-L-asparaginyl-L-phenylalanyl-L-tyrosyl-L-alanyl-L-tryptophyl-L-lysyl- CAS NO 915091-83-7


Acetyl Octapeptide-1 CAS NO 868844-74-0


Copper Tripeptide CAS NO 89030-95-5


N2-(1-Oxohexadecyl)-L-Lysyl-L-Valyl-(2S)-2,4-Diaminobutanoyl-L-Threonine Bis(Trifluoroacetate) (Salt) CAS NO 883558-32-5


(D-Ala2)-Leu-Enkephalin CAS NO 64963-01-5


Copper Peptide CAS NO 49557-75-7


Orexin A (17-33) CAS NO 343268-91-7


H-Lys-Cys-Asp-Ile-Cys-Thr-Asp-Glu-Tyr-Oh CAS NO 197171-78-1


L-Arginine, Glycyl-L-Valyl-L-Seryl-L-Tryptophylglycyl-L-Leucyl- CAS NO 1801959-12-5


H-Pro-Leu-Gly-Nh2 CAS NO 2002-44-0


Pinealon CAS NO 175175-23-2


Melanotan Ii CAS NO 121062-08-6


Goralatide CAS NO 127103-11-1


H-β-Ala-β-Ala-Oh CAS NO 2140-53-6


α-Msh (11-13) (Free Acid) CAS NO 67727-97-3


Nesiritide Acetate CAS NO 114471-18-0


Tachyplesin CAS NO 118231-04-2


L-Serine, N2-(1-Oxotetradecyl)-L-Lysyl-L-Threonyl-L-Threonyl-L-Lysyl- CAS NO 1392416-25-9


Exendin-4 CAS NO 141758-74-9


Bremelanotide Acetate CAS NO 1607799-13-2
Why choose US
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






