Description

Cecropin B (free acid) trifluoroacetate salt H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-OH trifluoroacetate salt is a synthetic, high-purity peptide analog of the natural antimicrobial peptide Cecropin B, provided as a trifluoroacetate salt to enhance solubility and stability. This compound is of significant interest for its potent, broad-spectrum antimicrobial activity against bacteria, fungi, and certain parasites, making it a valuable tool for research into novel therapeutic agents and antimicrobial mechanisms. It is primarily utilized by researchers and developers in the pharmaceutical, biotechnology, and life science sectors for drug discovery, peptide structure-activity relationship (SAR) studies, and the development of new anti-infective strategies.

Application

• Antimicrobial Research & Development: As a lead compound for studying novel antibiotic mechanisms and developing new classes of antimicrobial agents to combat drug-resistant pathogens.
• Biopharmaceutical Discovery: Used in preclinical research to evaluate the therapeutic potential of Cecropin B analogs for treating bacterial and fungal infections.
• Peptide Chemistry & SAR Studies: Serves as a reference standard and building block for synthesizing and testing modified peptide sequences to optimize potency, selectivity, and stability.
• Biomaterial & Coating Development: Investigated for incorporation into medical devices, wound dressings, or surface coatings to impart antimicrobial properties.
• Cell Biology & Immunology Research: Employed in studies to understand host-defense peptide interactions with microbial membranes and their immunomodulatory effects.
• Veterinary Pharmaceutical Research: Explored for potential applications in animal health as an alternative to conventional antibiotics.

Basic Information

Product Name	Cecropin B (free acid) trifluoroacetate salt H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-OH trifluoroacetate salt
CAS No.	203265-23-0
Molecular Formula	C185H316N56O49S • xC2HF3O2
Molecular Weight	~4000.0 g/mol (Free acid base, TFA salt content variable)
Synonyms	Cecropin B (porcine); Cecropin B TFA salt; H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-OH TFA; Antimicrobial Peptide Cecropin B; Apidaccin 1B; Cecropin-B; Cecropin B from Pig Intestine; Cecropin B (1-35), porcine; KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL TFA
EINECS	Contact for details

Quality Control

Our Cecropin B (free acid) trifluoroacetate salt is manufactured under strict quality management systems. Each batch undergoes rigorous analytical testing to ensure identity, purity, and consistency, meeting the high standards required for research and development applications. A comprehensive Certificate of Analysis (COA) is provided, detailing key parameters such as assay purity (HPLC), peptide content, and residual solvents. We support compliance with relevant guidelines for research-grade peptides.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below in a dry environment. This product is hygroscopic (moisture-sensitive). For long-term storage, consider desiccation. Allow the vial to equilibrate to room temperature before opening to minimize moisture absorption.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC/MS)	Conforms to reference standard
Purity (HPLC)	≥ 95%
Peptide Content	≥ 70% (by weight)
Amino Acid Analysis	Within ± 10% of theoretical
Single Impurity (HPLC)	≤ 1.0%
Water Content (KF)	≤ 8.0%
Acetate Content (HPIC)	≤ 10.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.