share

L-Cys-L-Ser-L-Asn-L-Leu-L-Ser-L-Thr-L-Cys-L-Val-L-Leu-Gly-L-Lys-L-Leu-L-Ser-L-Gln-L-Glu-L-Leu-L-His-L-Lys-L-Leu-L-Gln-L-Thr-L-Tyr-L-Pro-L-Arg-L-Thr-L-Asn-L-Thr-Gly-L-Ser-Gly-L-Thr-L-Pro-NH2 CAS NO 25596-79-6


Unit Price:

CAS No.:25596-79-6

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

L-Cys-L-Ser-L-Asn-L-Leu-L-Ser-L-Thr-L-Cys-L-Val-L-Leu-Gly-L-Lys-L-Leu-L-Ser-L-Gln-L-Glu-L-Leu-L-His-L-Lys-L-Leu-L-Gln-L-Thr-L-Tyr-L-Pro-L-Arg-L-Thr-L-Asn-L-Thr-Gly-L-Ser-Gly-L-Thr-L-Pro-NH2 is a synthetic peptide of significant interest in advanced biochemical research and pharmaceutical development. This compound, known for its specific sequence, is a critical intermediate for studying protein-protein interactions and developing novel therapeutic agents. It is primarily utilized by research institutions and pharmaceutical companies focused on endocrinology, metabolic disorders, and peptide-based drug discovery.

Application

  • Pharmaceutical Research & Development: Serves as a key intermediate or reference standard in the development of peptide-based therapeutics and diagnostic agents.
  • Biochemical Assay Development: Used as a substrate or ligand in enzymatic studies, receptor binding assays, and signal transduction pathway analysis.
  • Academic Research: Employed in university and institutional labs for fundamental studies in peptide chemistry, hormone action, and molecular biology.
  • Process Development & Scale-up: Acts as a benchmark material for optimizing synthetic peptide manufacturing processes, including solid-phase peptide synthesis (SPPS) and purification protocols.
  • Quality Control & Analytical Standards: Functions as a high-purity reference material for calibrating analytical instruments like HPLC and mass spectrometers in QC laboratories.

Basic Information

Item Detail
Product Name L-Cys-L-Ser-L-Asn-L-Leu-L-Ser-L-Thr-L-Cys-L-Val-L-Leu-Gly-L-Lys-L-Leu-L-Ser-L-Gln-L-Glu-L-Leu-L-His-L-Lys-L-Leu-L-Gln-L-Thr-L-Tyr-L-Pro-L-Arg-L-Thr-L-Asn-L-Thr-Gly-L-Ser-Gly-L-Thr-L-Pro-NH2
CAS No. 25596-79-6
Molecular Formula C149H244N44O47S2
Molecular Weight 3347.9 g/mol (theoretical)
Synonyms H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2; [Cys1, Cys7]-Peptide; Synthetic 34-mer peptide; Peptide sequence 1-34; Research peptide 25596-79-6; CSNSLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (single-letter abbreviation)
EINECS Contact for details

Quality Control

Our L-Cys-L-Ser-L-Asn-L-Leu-L-Ser-L-Thr-L-Cys-L-Val-L-Leu-Gly-L-Lys-L-Leu-L-Ser-L-Gln-L-Glu-L-Leu-L-His-L-Lys-L-Leu-L-Gln-L-Thr-L-Tyr-L-Pro-L-Arg-L-Thr-L-Asn-L-Thr-Gly-L-Ser-Gly-L-Thr-L-Pro-NH2 is manufactured under strict quality management systems. Each batch undergoes comprehensive analytical characterization to ensure identity, purity, and consistency. Certificates of Analysis (COA) detailing HPLC purity, amino acid analysis, mass spectrometry (MS) data, and other relevant tests are provided to guarantee it meets the stringent requirements of research and development applications.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below in a dry environment. For long-term storage, consider lyophilization and storage under inert atmosphere. Allow the vial to reach room temperature in a desiccator before opening to minimize moisture uptake. Keep containers tightly sealed when not in use.

Specification

Item Specification
Appearance White to off-white powder
Identification (HPLC/MS) Conforms to reference standard
Purity (HPLC) ≥ 95.0%
Single Impurity (HPLC) ≤ 1.0%
Amino Acid Composition Within ±10% of theoretical
Peptide Content ≥ 80.0% (by weight)
Water Content (KF) ≤ 5.0%
Acetate Content (HPIC) ≤ 10.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.