

share
L-Cys-L-Ser-L-Asn-L-Leu-L-Ser-L-Thr-L-Cys-L-Val-L-Leu-Gly-L-Lys-L-Leu-L-Ser-L-Gln-L-Glu-L-Leu-L-His-L-Lys-L-Leu-L-Gln-L-Thr-L-Tyr-L-Pro-L-Arg-L-Thr-L-Asn-L-Thr-Gly-L-Ser-Gly-L-Thr-L-Pro-NH2 CAS NO 25596-79-6
Unit Price:
CAS No.:25596-79-6
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
L-Cys-L-Ser-L-Asn-L-Leu-L-Ser-L-Thr-L-Cys-L-Val-L-Leu-Gly-L-Lys-L-Leu-L-Ser-L-Gln-L-Glu-L-Leu-L-His-L-Lys-L-Leu-L-Gln-L-Thr-L-Tyr-L-Pro-L-Arg-L-Thr-L-Asn-L-Thr-Gly-L-Ser-Gly-L-Thr-L-Pro-NH2 is a synthetic peptide of significant interest in advanced biochemical research and pharmaceutical development. This compound, known for its specific sequence, is a critical intermediate for studying protein-protein interactions and developing novel therapeutic agents. It is primarily utilized by research institutions and pharmaceutical companies focused on endocrinology, metabolic disorders, and peptide-based drug discovery.
Application
- Pharmaceutical Research & Development: Serves as a key intermediate or reference standard in the development of peptide-based therapeutics and diagnostic agents.
- Biochemical Assay Development: Used as a substrate or ligand in enzymatic studies, receptor binding assays, and signal transduction pathway analysis.
- Academic Research: Employed in university and institutional labs for fundamental studies in peptide chemistry, hormone action, and molecular biology.
- Process Development & Scale-up: Acts as a benchmark material for optimizing synthetic peptide manufacturing processes, including solid-phase peptide synthesis (SPPS) and purification protocols.
- Quality Control & Analytical Standards: Functions as a high-purity reference material for calibrating analytical instruments like HPLC and mass spectrometers in QC laboratories.
Basic Information
| Item | Detail |
|---|---|
| Product Name | L-Cys-L-Ser-L-Asn-L-Leu-L-Ser-L-Thr-L-Cys-L-Val-L-Leu-Gly-L-Lys-L-Leu-L-Ser-L-Gln-L-Glu-L-Leu-L-His-L-Lys-L-Leu-L-Gln-L-Thr-L-Tyr-L-Pro-L-Arg-L-Thr-L-Asn-L-Thr-Gly-L-Ser-Gly-L-Thr-L-Pro-NH2 |
| CAS No. | 25596-79-6 |
| Molecular Formula | C149H244N44O47S2 |
| Molecular Weight | 3347.9 g/mol (theoretical) |
| Synonyms | H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2; [Cys1, Cys7]-Peptide; Synthetic 34-mer peptide; Peptide sequence 1-34; Research peptide 25596-79-6; CSNSLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (single-letter abbreviation) |
| EINECS | Contact for details |
Quality Control
Our L-Cys-L-Ser-L-Asn-L-Leu-L-Ser-L-Thr-L-Cys-L-Val-L-Leu-Gly-L-Lys-L-Leu-L-Ser-L-Gln-L-Glu-L-Leu-L-His-L-Lys-L-Leu-L-Gln-L-Thr-L-Tyr-L-Pro-L-Arg-L-Thr-L-Asn-L-Thr-Gly-L-Ser-Gly-L-Thr-L-Pro-NH2 is manufactured under strict quality management systems. Each batch undergoes comprehensive analytical characterization to ensure identity, purity, and consistency. Certificates of Analysis (COA) detailing HPLC purity, amino acid analysis, mass spectrometry (MS) data, and other relevant tests are provided to guarantee it meets the stringent requirements of research and development applications.
Storage
Preserve in a tightly closed container, protected from light. Store at -20°C or below in a dry environment. For long-term storage, consider lyophilization and storage under inert atmosphere. Allow the vial to reach room temperature in a desiccator before opening to minimize moisture uptake. Keep containers tightly sealed when not in use.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white powder |
| Identification (HPLC/MS) | Conforms to reference standard |
| Purity (HPLC) | ≥ 95.0% |
| Single Impurity (HPLC) | ≤ 1.0% |
| Amino Acid Composition | Within ±10% of theoretical |
| Peptide Content | ≥ 80.0% (by weight) |
| Water Content (KF) | ≤ 5.0% |
| Acetate Content (HPIC) | ≤ 10.0% |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


L-Arginine, L-asparaginyl-L-α-glutamyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-valyl-L-prolyl-L-α-aspartyl-L-threonyl-L-lysyl-L-valyl-L-asparaginyl-L-phenylalanyl-L-tyrosyl-L-alanyl-L-tryptophyl-L-lysyl- CAS NO 915091-83-7


Acetyl Octapeptide-1 CAS NO 868844-74-0


N2-(1-Oxohexadecyl)-L-Lysyl-L-Valyl-(2S)-2,4-Diaminobutanoyl-L-Threonine Bis(Trifluoroacetate) (Salt) CAS NO 883558-32-5


Copper Tripeptide CAS NO 89030-95-5


(D-Ala2)-Leu-Enkephalin CAS NO 64963-01-5


Copper Peptide CAS NO 49557-75-7


Orexin A (17-33) CAS NO 343268-91-7


H-Lys-Cys-Asp-Ile-Cys-Thr-Asp-Glu-Tyr-Oh CAS NO 197171-78-1


H-Pro-Leu-Gly-Nh2 CAS NO 2002-44-0


Pinealon CAS NO 175175-23-2


L-Arginine, Glycyl-L-Valyl-L-Seryl-L-Tryptophylglycyl-L-Leucyl- CAS NO 1801959-12-5


Melanotan Ii CAS NO 121062-08-6


Goralatide CAS NO 127103-11-1


H-β-Ala-β-Ala-Oh CAS NO 2140-53-6


α-Msh (11-13) (Free Acid) CAS NO 67727-97-3


Nesiritide Acetate CAS NO 114471-18-0


Tachyplesin CAS NO 118231-04-2


Exendin-4 CAS NO 141758-74-9


L-Serine, N2-(1-Oxotetradecyl)-L-Lysyl-L-Threonyl-L-Threonyl-L-Lysyl- CAS NO 1392416-25-9


Bremelanotide Acetate CAS NO 1607799-13-2
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






