share

Nesfatin-1 (Rat) CAS NO 917528-37-1


Unit Price:

CAS No.:917528-37-1

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

Nesfatin-1 (Rat) is a bioactive neuropeptide derived from the precursor protein nucleobindin-2 (NUCB2). This compound is of significant interest in metabolic and neuroendocrine research due to its role in regulating appetite, energy homeostasis, and glucose metabolism. It is primarily utilized by pharmaceutical R&D teams, academic research institutions, and biotechnology companies focused on metabolic disorders, obesity, and diabetes research.

Application

  • Biomedical Research: Used as a critical reagent in studies investigating the central and peripheral mechanisms of appetite suppression and satiety signaling.
  • Metabolic Disorder Studies: Applied in preclinical research models to explore potential therapeutic pathways for obesity, type 2 diabetes, and related metabolic syndromes.
  • Neuroendocrine Research: Essential for investigating the interaction between adipose tissue, the brain, and the endocrine system.
  • In Vitro Assay Development: Serves as a standard or reference compound in developing cell-based assays and high-throughput screening platforms for drug discovery.
  • Signal Transduction Analysis: Used to study intracellular signaling cascades, particularly those involving calcium mobilization and other second messenger systems activated by NUCB2-derived peptides.
  • Antibody & Assay Kit Production: Acts as an immunogen for antibody generation or as a calibrator in ELISA and other immunoassay kits targeting Nesfatin-1.

Basic Information

Product Name Nesfatin-1 (Rat)
CAS No. 917528-37-1
Molecular Formula C198H310N56O58S
Molecular Weight 4377.0 g/mol
Synonyms Nesfatin-1, rat; NUCB2(1-82), rat; Nucleobindin-2 derived peptide (1-82); NEFA/nucleobindin-2-Encoded Satiety- and FAT-Influencing proteiN-1; NUCB2 Nesfatin-1; Anorexigenic peptide Nesfatin-1; M30 Nesfatin-1; L30 Nesfatin-1
EINECS Contact for details

Quality Control

Our Nesfatin-1 (Rat) is produced under stringent conditions to ensure the highest standards of purity and biological activity, suitable for sensitive research applications. Each batch undergoes comprehensive analytical testing, including HPLC for purity verification and mass spectrometry for identity confirmation. A Certificate of Analysis (COA) detailing purity, peptide content, and endotoxin levels is provided with every shipment to guarantee traceability and compliance with your research protocols.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake. Aliquot reconstituted solutions to avoid repeated freeze-thaw cycles.

Specification

Item Specification
Appearance White to off-white lyophilized powder
Identification (HPLC & MS) Conforms to reference standard
Purity (HPLC) ≥ 95%
Peptide Content ≥ 80% (by weight)
Amino Acid Sequence MDPNMEQESYKKVLEYLKELDKRRGSNLFQAIKRYLTSILEESSQQQEYKILECVKILIQQYAKNISNIL
Molecular Weight 4377.0 Da (average)
Solubility Soluble in water or dilute acetic acid
Endotoxin Level < 1.0 EU/µg

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.