share

Nesfatin-1 (Human) CAS NO 917528-35-9


Unit Price:

CAS No.:917528-35-9

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

Nesfatin-1 (Human) CAS NO 917528-35-9 is a bioactive peptide hormone derived from the precursor protein nucleobindin-2 (NUCB2), playing a significant role in the central regulation of appetite, energy homeostasis, and stress responses. Its high purity and biological activity make it a critical reagent for advancing metabolic and neuroendocrine research. This peptide is essential for pharmaceutical R&D, academic institutions, and biotechnology companies focused on developing novel therapeutics for obesity, diabetes, and related metabolic disorders.

Application

  • Biomedical Research: Fundamental studies on appetite regulation, energy balance, and the central nervous system's role in metabolism.
  • Drug Discovery & Development: Screening and validation of potential drug candidates targeting the Nesfatin-1 pathway for treating obesity and type 2 diabetes.
  • In Vitro & In Vivo Assays: Used as a reference standard in cell-based assays and animal model studies to investigate its physiological effects.
  • Diagnostic Development: Potential use in the development of immunoassays and diagnostic kits for metabolic syndrome markers.
  • Neuroscience Research: Investigation of its anxiolytic and stress-modulating properties within the brain.
  • Academic & Institutional Use: A key tool for university laboratories and research institutes conducting cutting-edge endocrinology and pharmacology studies.

Basic Information

Product Name Nesfatin-1 (Human)
CAS No. 917528-35-9
Molecular Formula C388H620N112O115S2
Molecular Weight 8690.2 g/mol
Synonyms Nesfatin-1; NUCB2(1-82); Nucleobindin-2 derived peptide (1-82); Human Nesfatin-1; NUCB2 Nesfatin-1; NESF-1; NEFA/NUCB2-derived satiety and fat-influencing protein-1; Appetite-regulating peptide Nesfatin-1
EINECS Contact for details

Quality Control

Our Nesfatin-1 (Human) is produced under stringent conditions to ensure the highest standards of purity and biological integrity, suitable for sensitive research applications. Each batch is subjected to comprehensive analytical testing, including HPLC for purity assessment and mass spectrometry for identity confirmation. Certificates of Analysis (COA) detailing purity, peptide content, and endotoxin levels are available upon request.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below. This product is hygroscopic (moisture-sensitive). For long-term storage, it is recommended to store the lyophilized powder desiccated at -20°C. Reconstituted solutions should be aliquoted and stored at -80°C to avoid repeated freeze-thaw cycles.

Specification

Item Specification
Appearance White to off-white lyophilized powder
Identification (HPLC & MS) Conforms to reference standard
Purity (HPLC) ≥ 95%
Peptide Content ≥ 80% (by weight)
Amino Acid Sequence MDPNMEQKIKKSELTNLQELNKLCNQFEKLKSIIPSGKKYYPEEDTVLSFREKILKNLMERKICTRL
Molecular Weight 8690.2 Da (average)
Solubility Soluble in water or dilute acetic acid
Endotoxin Level < 1.0 EU/µg

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.