Description

Glp-2 (Human) CAS NO 99120-49-7 is a synthetic 33-amino acid peptide hormone, identical to the naturally occurring human glucagon-like peptide-2. This compound is of significant interest for its potent role in stimulating intestinal mucosal growth and function. It is primarily utilized by pharmaceutical researchers and manufacturers in the development of novel therapeutics for gastrointestinal disorders, including short bowel syndrome and intestinal failure.

Application

• Pharmaceutical Research & Development (R&D): A critical reference standard and active ingredient in preclinical and clinical studies for gut-related therapies.
• Therapeutic Agent Production: Serves as the active pharmaceutical ingredient (API) in the manufacture of drugs designed to treat intestinal insufficiency and malabsorption.
• Biochemical Research: Used in laboratory studies to investigate the mechanisms of intestinal cell proliferation, nutrient absorption, and gut barrier function.
• Cell Culture & In Vitro Studies: Employed as a growth factor to study and enhance the viability and growth of intestinal epithelial cells.
• Diagnostic Development: Potential use in the development of diagnostic assays and kits for measuring GLP-2 levels in biological samples.

Basic Information

Product Name	Glp-2 (Human)
CAS No.	99120-49-7
Molecular Formula	C164H251N43O55
Molecular Weight	3763.0 g/mol
Synonyms	Glucagon-like peptide 2 (human); GLP-2; hGLP-2; Teduglutide (drug substance); GLP2; Glucagon-Like Peptide-2 (1-33), Human; [Gly2]-GLP-2; HADGSFSDEMNTILDNLAARDFINWLIQTKITD
EINECS	Contact for details

Quality Control

Our Glp-2 (Human) is manufactured under strict quality management systems. Each batch undergoes comprehensive analytical testing, including HPLC for purity, MS for identity confirmation, and stringent tests for residual solvents and related substances. Certificates of Analysis (COA) detailing all specifications are provided to ensure compliance with your research or cGMP-grade requirements.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to reach room temperature before opening to minimize moisture absorption. For long-term storage, keep desiccated.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC/MS)	Conforms to reference standard
Purity (HPLC)	≥ 95.0%
Peptide Content	≥ 80.0%
Water Content (KF)	≤ 10.0%
Acetate Content (HPLC)	≤ 15.0%
Single Impurity (HPLC)	≤ 2.0%
Total Impurities (HPLC)	≤ 5.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.