Description

β-Endorphin (13-31) is a bioactive peptide fragment derived from the endogenous opioid peptide β-endorphin. This compound is of significant interest for its role in neurobiological research and its potential as a tool for studying opioid receptor interactions and pain modulation pathways. It is primarily utilized by research institutions and pharmaceutical developers in the fields of neuroscience, pharmacology, and endocrinology. CAS NO 98420-26-9.

Application

• Neuroscience Research: Used as a reference standard and active agent in studies of endogenous opioid systems, stress response, and reward mechanisms.
• Pharmacological Studies: Employed in in vitro and in vivo assays to investigate receptor binding affinity, signal transduction, and analgesic effects.
• Biochemical Analysis: Serves as a critical component in the development and validation of immunoassays (ELISA, RIA) for β-endorphin detection.
• Drug Discovery: Acts as a lead compound or molecular probe for designing novel therapeutics targeting opioid receptors for pain management.
• Academic & Clinical Research: Supports fundamental research into the physiological and pathological roles of endorphins in mood, behavior, and immune function.

Basic Information

Product Name	β-Endorphin (13-31)
CAS No.	98420-26-9
Molecular Formula	C92H150N26O27S
Molecular Weight	2099.4 g/mol
Synonyms	β-Endorphin (13-31); β-Endorphin Fragment 13-31; H-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH; β-Lipotropin (61-91) fragment 13-31; LYPGFMTSEKSQTPLVTLFKNAIIKNAYKKGE; Opioid peptide β-EP (13-31)
EINECS	Contact for details

Quality Control

Our β-Endorphin (13-31) is produced under stringent conditions to ensure high purity and batch-to-batch consistency, suitable for sensitive research applications. Each lot undergoes comprehensive analytical testing, including HPLC for purity and MS for identity confirmation. A Certificate of Analysis (COA) detailing all specifications is provided with every shipment to guarantee compliance with your research requirements.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below in a dry environment. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature before opening to minimize moisture absorption.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC/MS)	Conforms to reference standard
Purity (HPLC)	≥ 95%
Peptide Content	≥ 80% (by weight)
Water Content (KF)	≤ 5.0%
Solubility	Soluble in water, acetic acid, DMSO

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.