

share
His-Ala-Asp-Ala-Val-Phe-Thr-Ala-Ala-Tyr-Ala-Arg-Leu-Arg-Lys-Gln-Met-Ala-Ala-Lys-Lys-Ala-Leu-Ala-Ala-Ile-Ala-Ala-Nh2 CAS NO 866552-34-3
Unit Price:
CAS No.:866552-34-3
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
His-Ala-Asp-Ala-Val-Phe-Thr-Ala-Ala-Tyr-Ala-Arg-Leu-Arg-Lys-Gln-Met-Ala-Ala-Lys-Lys-Ala-Leu-Ala-Ala-Ile-Ala-Ala-Nh2 CAS NO 866552-34-3 is a synthetic peptide sequence, also known as a cell-penetrating peptide (CPP) derivative, designed for enhanced cellular uptake and delivery of bioactive cargo. This compound is critical for advancing research and development in targeted drug delivery systems and molecular biology applications. It is primarily utilized by pharmaceutical R&D teams, biotechnology companies, and academic research institutions focused on novel therapeutic modalities.
Application
- Drug Delivery Vector: As a cell-penetrating peptide (CPP), it facilitates the intracellular delivery of impermeable therapeutic molecules, including proteins, nucleic acids (siRNA, DNA), and small molecule drugs.
- Bioconjugation & Probe Development: Serves as a versatile scaffold for conjugating fluorescent dyes, affinity tags, or other functional groups to create targeted molecular probes for imaging and diagnostics.
- Research Tool in Cell Biology: Used to study mechanisms of membrane translocation, intracellular trafficking, and to modulate specific cellular pathways by delivering inhibitory peptides or proteins.
- Vaccine Adjuvant & Immunotherapy: Investigated for its potential to enhance antigen presentation and immune response in next-generation vaccine and cancer immunotherapy platforms.
- Cosmeceutical Research: Explored in topical formulations for the potential transdermal delivery of active ingredients targeting skin repair and anti-aging.
- Neuroscience Research: Applied in studies requiring delivery of cargo across the blood-brain barrier or into neuronal cells for neurological disease modeling.
Basic Information
| Product Name | His-Ala-Asp-Ala-Val-Phe-Thr-Ala-Ala-Tyr-Ala-Arg-Leu-Arg-Lys-Gln-Met-Ala-Ala-Lys-Lys-Ala-Leu-Ala-Ala-Ile-Ala-Ala-Nh2 |
| CAS No. | 866552-34-3 |
| Molecular Formula | C148H250N52O41S |
| Molecular Weight | 3299.9 g/mol |
| Synonyms | HADAVFTAAYARLRKQMAAKKALAAIA-NH2; CPP Derivative; Cell Penetrating Peptide Sequence; TAT-derived Peptide Analog; (Arg)9-Like Transport Peptide; Synthetic Cationic Peptide; Carrier Peptide for Intracellular Delivery; H-(His-Ala-Asp-Ala-Val-Phe-Thr-Ala-Ala-Tyr-Ala-Arg-Leu-Arg-Lys-Gln-Met-Ala-Ala-Lys-Lys-Ala-Leu-Ala-Ala-Ile-Ala-Ala)-NH2 |
| EINECS | Contact for details |
Quality Control
Our peptide products are manufactured under cGMP-like conditions and undergo rigorous analytical testing to ensure identity, purity, and consistency. Each batch is supported by a comprehensive Certificate of Analysis (COA) detailing purity by HPLC, mass spectrometry (MS) confirmation, amino acid analysis (AAA), and endotoxin levels where applicable. We adhere to stringent quality standards suitable for research and pre-clinical development.
Storage
Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a dry environment before opening to minimize moisture uptake.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (MS) | Consistent with theoretical molecular weight |
| Purity (HPLC) | ≥ 95% |
| Single Impurity (HPLC) | ≤ 1.0% |
| Amino Acid Composition | Within ±10% of theoretical |
| Peptide Content | ≥ 80% |
| Water Content (KF) | ≤ 5.0% |
| Acetate Content (HPIC) | ≤ 10.0% |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


L-Arginine, L-asparaginyl-L-α-glutamyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-valyl-L-prolyl-L-α-aspartyl-L-threonyl-L-lysyl-L-valyl-L-asparaginyl-L-phenylalanyl-L-tyrosyl-L-alanyl-L-tryptophyl-L-lysyl- CAS NO 915091-83-7


Acetyl Octapeptide-1 CAS NO 868844-74-0


N2-(1-Oxohexadecyl)-L-Lysyl-L-Valyl-(2S)-2,4-Diaminobutanoyl-L-Threonine Bis(Trifluoroacetate) (Salt) CAS NO 883558-32-5


Copper Tripeptide CAS NO 89030-95-5


(D-Ala2)-Leu-Enkephalin CAS NO 64963-01-5


Copper Peptide CAS NO 49557-75-7


Orexin A (17-33) CAS NO 343268-91-7


H-Lys-Cys-Asp-Ile-Cys-Thr-Asp-Glu-Tyr-Oh CAS NO 197171-78-1


H-Pro-Leu-Gly-Nh2 CAS NO 2002-44-0


Pinealon CAS NO 175175-23-2


L-Arginine, Glycyl-L-Valyl-L-Seryl-L-Tryptophylglycyl-L-Leucyl- CAS NO 1801959-12-5


Melanotan Ii CAS NO 121062-08-6


Goralatide CAS NO 127103-11-1


H-β-Ala-β-Ala-Oh CAS NO 2140-53-6


α-Msh (11-13) (Free Acid) CAS NO 67727-97-3


Nesiritide Acetate CAS NO 114471-18-0


Tachyplesin CAS NO 118231-04-2


Exendin-4 CAS NO 141758-74-9


L-Serine, N2-(1-Oxotetradecyl)-L-Lysyl-L-Threonyl-L-Threonyl-L-Lysyl- CAS NO 1392416-25-9


Bremelanotide Acetate CAS NO 1607799-13-2
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






