Description

His-Ala-Asp-Ala-Val-Phe-Thr-Ala-Ala-Tyr-Ala-Arg-Leu-Arg-Lys-Gln-Met-Ala-Ala-Lys-Lys-Ala-Leu-Ala-Ala-Ile-Ala-Ala-Nh2 CAS NO 866552-34-3 is a synthetic peptide sequence, also known as a cell-penetrating peptide (CPP) derivative, designed for enhanced cellular uptake and delivery of bioactive cargo. This compound is critical for advancing research and development in targeted drug delivery systems and molecular biology applications. It is primarily utilized by pharmaceutical R&D teams, biotechnology companies, and academic research institutions focused on novel therapeutic modalities.

Application

• Drug Delivery Vector: As a cell-penetrating peptide (CPP), it facilitates the intracellular delivery of impermeable therapeutic molecules, including proteins, nucleic acids (siRNA, DNA), and small molecule drugs.
• Bioconjugation & Probe Development: Serves as a versatile scaffold for conjugating fluorescent dyes, affinity tags, or other functional groups to create targeted molecular probes for imaging and diagnostics.
• Research Tool in Cell Biology: Used to study mechanisms of membrane translocation, intracellular trafficking, and to modulate specific cellular pathways by delivering inhibitory peptides or proteins.
• Vaccine Adjuvant & Immunotherapy: Investigated for its potential to enhance antigen presentation and immune response in next-generation vaccine and cancer immunotherapy platforms.
• Cosmeceutical Research: Explored in topical formulations for the potential transdermal delivery of active ingredients targeting skin repair and anti-aging.
• Neuroscience Research: Applied in studies requiring delivery of cargo across the blood-brain barrier or into neuronal cells for neurological disease modeling.

Basic Information

Product Name	His-Ala-Asp-Ala-Val-Phe-Thr-Ala-Ala-Tyr-Ala-Arg-Leu-Arg-Lys-Gln-Met-Ala-Ala-Lys-Lys-Ala-Leu-Ala-Ala-Ile-Ala-Ala-Nh2
CAS No.	866552-34-3
Molecular Formula	C148H250N52O41S
Molecular Weight	3299.9 g/mol
Synonyms	HADAVFTAAYARLRKQMAAKKALAAIA-NH2; CPP Derivative; Cell Penetrating Peptide Sequence; TAT-derived Peptide Analog; (Arg)9-Like Transport Peptide; Synthetic Cationic Peptide; Carrier Peptide for Intracellular Delivery; H-(His-Ala-Asp-Ala-Val-Phe-Thr-Ala-Ala-Tyr-Ala-Arg-Leu-Arg-Lys-Gln-Met-Ala-Ala-Lys-Lys-Ala-Leu-Ala-Ala-Ile-Ala-Ala)-NH2
EINECS	Contact for details

Quality Control

Our peptide products are manufactured under cGMP-like conditions and undergo rigorous analytical testing to ensure identity, purity, and consistency. Each batch is supported by a comprehensive Certificate of Analysis (COA) detailing purity by HPLC, mass spectrometry (MS) confirmation, amino acid analysis (AAA), and endotoxin levels where applicable. We adhere to stringent quality standards suitable for research and pre-clinical development.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a dry environment before opening to minimize moisture uptake.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (MS)	Consistent with theoretical molecular weight
Purity (HPLC)	≥ 95%
Single Impurity (HPLC)	≤ 1.0%
Amino Acid Composition	Within ±10% of theoretical
Peptide Content	≥ 80%
Water Content (KF)	≤ 5.0%
Acetate Content (HPIC)	≤ 10.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.