

share
H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Nh2 CAS NO 83139-29-1
Unit Price:
CAS No.:83139-29-1
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Nh2 is a synthetic peptide of significant interest in advanced biochemical research and development. This compound is valued for its high purity and structural complexity, making it a critical reagent for studying protein-protein interactions, enzyme function, and signal transduction pathways. It is primarily utilized by pharmaceutical R&D teams, academic research institutions, and biotechnology companies focused on peptide-based therapeutics and diagnostic tools.
Application
- Biochemical Research: Used as a reference standard or substrate in enzymatic assays and mechanistic studies of biological pathways.
- Pharmaceutical Development: Serves as a key intermediate or active pharmaceutical ingredient (API) in the discovery and preclinical testing of novel peptide therapeutics.
- Diagnostic Reagent Production: Employed in the development of immunoassays, biosensors, and other diagnostic kits that require specific peptide sequences for target binding.
- Cell Biology Studies: Applied in research investigating cell signaling, receptor-ligand interactions, and intracellular communication mechanisms.
- Antibody Production: Acts as an immunogen for generating custom polyclonal or monoclonal antibodies against specific epitopes.
- Proteomics and Mass Spectrometry: Utilized as a calibration standard or a model compound in mass spectrometry-based protein analysis and identification.
Basic Information
| Product Name | H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Nh2 |
| CAS No. | 83139-29-1 |
| Molecular Formula | C164H261N49O46S2 |
| Molecular Weight | ~3726.3 g/mol |
| Synonyms | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-NH2; Peptide SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Amide; 34-Amino Acid Peptide (83139-29-1); H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-amide; Synthetic Polypeptide 83139-29-1 |
| EINECS | Contact for details |
Quality Control
Our H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Nh2 is manufactured under controlled conditions to ensure high purity and batch-to-batch consistency. Each lot undergoes comprehensive analytical testing, including HPLC for purity and MS for identity confirmation. Certificates of Analysis (COA) detailing all specifications are provided and available upon request to support your quality assurance protocols.
Storage
Preserve in a tightly closed container, protected from light. Store at -20°C or below in a freezer. Due to its hygroscopic (moisture-sensitive) nature, the container must be sealed under an inert atmosphere or with desiccant after opening. Allow the vial to equilibrate to room temperature before opening to minimize condensation and moisture uptake.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC) | Retention time corresponds to reference standard |
| Identification (MS) | Mass spectrum consistent with theoretical molecular weight |
| Purity (HPLC) | ≥ 95.0% |
| Single Impurity (HPLC) | ≤ 1.0% |
| Water Content (KF) | ≤ 5.0% |
| Peptide Content | ≥ 80.0% |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


L-Arginine, L-asparaginyl-L-α-glutamyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-valyl-L-prolyl-L-α-aspartyl-L-threonyl-L-lysyl-L-valyl-L-asparaginyl-L-phenylalanyl-L-tyrosyl-L-alanyl-L-tryptophyl-L-lysyl- CAS NO 915091-83-7


Acetyl Octapeptide-1 CAS NO 868844-74-0


N2-(1-Oxohexadecyl)-L-Lysyl-L-Valyl-(2S)-2,4-Diaminobutanoyl-L-Threonine Bis(Trifluoroacetate) (Salt) CAS NO 883558-32-5


Copper Tripeptide CAS NO 89030-95-5


(D-Ala2)-Leu-Enkephalin CAS NO 64963-01-5


Copper Peptide CAS NO 49557-75-7


Orexin A (17-33) CAS NO 343268-91-7


H-Lys-Cys-Asp-Ile-Cys-Thr-Asp-Glu-Tyr-Oh CAS NO 197171-78-1


H-Pro-Leu-Gly-Nh2 CAS NO 2002-44-0


Pinealon CAS NO 175175-23-2


L-Arginine, Glycyl-L-Valyl-L-Seryl-L-Tryptophylglycyl-L-Leucyl- CAS NO 1801959-12-5


Melanotan Ii CAS NO 121062-08-6


Goralatide CAS NO 127103-11-1


H-β-Ala-β-Ala-Oh CAS NO 2140-53-6


α-Msh (11-13) (Free Acid) CAS NO 67727-97-3


Nesiritide Acetate CAS NO 114471-18-0


Tachyplesin CAS NO 118231-04-2


Exendin-4 CAS NO 141758-74-9


L-Serine, N2-(1-Oxotetradecyl)-L-Lysyl-L-Threonyl-L-Threonyl-L-Lysyl- CAS NO 1392416-25-9


Bremelanotide Acetate CAS NO 1607799-13-2
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






