Description

H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Nh2 is a synthetic peptide of significant interest in advanced biochemical research and development. This compound is valued for its high purity and structural complexity, making it a critical reagent for studying protein-protein interactions, enzyme function, and signal transduction pathways. It is primarily utilized by pharmaceutical R&D teams, academic research institutions, and biotechnology companies focused on peptide-based therapeutics and diagnostic tools.

Application

• Biochemical Research: Used as a reference standard or substrate in enzymatic assays and mechanistic studies of biological pathways.
• Pharmaceutical Development: Serves as a key intermediate or active pharmaceutical ingredient (API) in the discovery and preclinical testing of novel peptide therapeutics.
• Diagnostic Reagent Production: Employed in the development of immunoassays, biosensors, and other diagnostic kits that require specific peptide sequences for target binding.
• Cell Biology Studies: Applied in research investigating cell signaling, receptor-ligand interactions, and intracellular communication mechanisms.
• Antibody Production: Acts as an immunogen for generating custom polyclonal or monoclonal antibodies against specific epitopes.
• Proteomics and Mass Spectrometry: Utilized as a calibration standard or a model compound in mass spectrometry-based protein analysis and identification.

Basic Information

Product Name	H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Nh2
CAS No.	83139-29-1
Molecular Formula	C164H261N49O46S2
Molecular Weight	~3726.3 g/mol
Synonyms	SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-NH2; Peptide SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Amide; 34-Amino Acid Peptide (83139-29-1); H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-amide; Synthetic Polypeptide 83139-29-1
EINECS	Contact for details

Quality Control

Our H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Nh2 is manufactured under controlled conditions to ensure high purity and batch-to-batch consistency. Each lot undergoes comprehensive analytical testing, including HPLC for purity and MS for identity confirmation. Certificates of Analysis (COA) detailing all specifications are provided and available upon request to support your quality assurance protocols.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below in a freezer. Due to its hygroscopic (moisture-sensitive) nature, the container must be sealed under an inert atmosphere or with desiccant after opening. Allow the vial to equilibrate to room temperature before opening to minimize condensation and moisture uptake.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC)	Retention time corresponds to reference standard
Identification (MS)	Mass spectrum consistent with theoretical molecular weight
Purity (HPLC)	≥ 95.0%
Single Impurity (HPLC)	≤ 1.0%
Water Content (KF)	≤ 5.0%
Peptide Content	≥ 80.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.