Description

L-His-L-Ser-L-Asp-Gly-L-Leu-L-Phe-L-Thr-L-Ser-L-Glu-L-Tyr-L-Ser-L-Lys-L-Met-L-Arg-Gly-L-Asn-L-Ala-L-Gln-L-Val-L-Gln-L-Lys-L-Phe-L-Ile-L-Gln-L-Asn-L-Leu-L-Met-Nh2 is a high-purity, synthetic peptide with the CAS number 76363-27-4. This compound is a critical building block for advanced research and development in life sciences, offering precise molecular structure for targeted applications. It is primarily utilized by pharmaceutical R&D teams, biotechnology firms, and academic research institutions engaged in peptide-based drug discovery and biochemical studies.

Application

• Pharmaceutical Research & Development: Serves as a key intermediate or reference standard in the discovery and development of novel peptide therapeutics and diagnostic agents.
• Biochemical Research: Used in structure-activity relationship (SAR) studies to understand protein-protein interactions and enzyme functions.
• Peptide Synthesis: Acts as a crucial fragment for the solid-phase or solution-phase synthesis of longer, complex peptide sequences.
• Cell Biology Studies: Employed in research to investigate cellular signaling pathways, receptor binding, and other biological mechanisms.
• Reference Standard: Provides a high-purity benchmark for analytical method development, validation, and quality control in laboratory settings.
• Antigen Synthesis: Can be used in the development of specific antigens for antibody production and immunological assays.

Basic Information

Product Name	L-His-L-Ser-L-Asp-Gly-L-Leu-L-Phe-L-Thr-L-Ser-L-Glu-L-Tyr-L-Ser-L-Lys-L-Met-L-Arg-Gly-L-Asn-L-Ala-L-Gln-L-Val-L-Gln-L-Lys-L-Phe-L-Ile-L-Gln-L-Asn-L-Leu-L-Met-Nh2
CAS No.	76363-27-4
Molecular Formula	C138H216N42O43S
Molecular Weight	3167.5 g/mol (theoretical)
Synonyms	H-His-Ser-Asp-Gly-Leu-Phe-Thr-Ser-Glu-Tyr-Ser-Lys-Met-Arg-Gly-Asn-Ala-Gln-Val-Gln-Lys-Phe-Ile-Gln-Asn-Leu-Met-NH2; HSDGLFTSESYKMRGNAQVQKFIQNLM-NH2; Peptide Fragment (1-27); Synthetic Peptide 76363-27-4; [Met27]-Peptide Amide; Custom Sequence Peptide; Research-Grade Peptide
EINECS	Contact for details

Quality Control

Our L-His-L-Ser-L-Asp-Gly-L-Leu-L-Phe-L-Thr-L-Ser-L-Glu-L-Tyr-L-Ser-L-Lys-L-Met-L-Arg-Gly-L-Asn-L-Ala-L-Gln-L-Val-L-Gln-L-Lys-L-Phe-L-Ile-L-Gln-L-Asn-L-Leu-L-Met-Nh2 is manufactured under strict quality systems. Each batch undergoes comprehensive analytical testing, including HPLC for purity, mass spectrometry (MS) for identity confirmation, and amino acid analysis. Certificates of Analysis (COA) detailing all specifications are provided to ensure traceability and compliance with your research requirements.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below for long-term stability. This product is hygroscopic (moisture-sensitive). Allow the vial to reach room temperature in a desiccator before opening to prevent condensation and moisture uptake. For short-term use, store at 2-8°C.

Specification

Item	Specification
Appearance	White to off-white powder
Identification (HPLC/MS)	Conforms to reference
Purity (HPLC)	≥ 95.0%
Single Impurity (HPLC)	≤ 1.0%
Amino Acid Composition	Within ±10% of theoretical
Water Content (KF)	≤ 5.0%
Peptide Content	≥ 80.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.