share

Lunasin CAS NO 496823-34-8


Unit Price:

CAS No.:496823-34-8

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

Lunasin CAS NO 496823-34-8 is a bioactive peptide derived from soybeans, recognized for its unique chromatin-binding properties and potential health-modulating effects. This compound is of significant interest for its role in cellular regulation and as a functional ingredient in advanced nutraceutical and cosmeceutical formulations. It is primarily sought by research institutions, pharmaceutical developers, and manufacturers in the dietary supplement and functional food industries for product innovation and clinical studies.

Application

  • Research and development of novel nutraceuticals and functional foods targeting cellular health.
  • Key ingredient in dietary supplements formulated for antioxidant and anti-inflammatory support.
  • Active component in cosmeceutical products for skin health and anti-aging applications.
  • Biochemical research tool for studying epigenetic regulation and peptide-mediated biological pathways.
  • Development of specialized clinical nutrition products and medical foods.
  • Formulation of veterinary health products and animal feed supplements.

Basic Information

Product Name Lunasin
CAS No. 496823-34-8
Molecular Formula C₁₈₈H₃₁₇N₅₅O₅₇S
Molecular Weight ~ 5.5 kDa
Synonyms Soybean Lunasin Peptide; Lunasin Peptide; Bowman-Birk Peptide Lunasin; SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD; Lunasin (soy); 43-mer peptide Lunasin; Lunasin bioactive peptide; Lunasin soy peptide
EINECS Contact for details

Quality Control

Our Lunasin is produced and tested under strict quality management systems to ensure high purity and batch-to-batch consistency. We provide comprehensive analytical data, including purity by HPLC and peptide content analysis. A Certificate of Analysis (COA) detailing identity, purity, and specific tests is available for every batch to support your quality assurance and regulatory compliance needs.

Storage

Preserve in a tightly closed container, protected from light. Store in a cool, dry place at 2-8°C for long-term stability. This product is hygroscopic (moisture-sensitive) and should be handled under dry conditions to prevent degradation.

Specification

Item Specification
Appearance White to off-white powder
Identification (HPLC/MS) Conforms
Assay (HPLC) ≥ 95.0%
Peptide Content ≥ 80.0%
Water Content (KF) ≤ 5.0%
Residue on Ignition ≤ 1.0%
Heavy Metals ≤ 20 ppm
Microbiological Analysis Meets standard specifications

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.