Description

Lunasin CAS NO 496823-34-8 is a bioactive peptide derived from soybeans, recognized for its unique chromatin-binding properties and potential health-modulating effects. This compound is of significant interest for its role in cellular regulation and as a functional ingredient in advanced nutraceutical and cosmeceutical formulations. It is primarily sought by research institutions, pharmaceutical developers, and manufacturers in the dietary supplement and functional food industries for product innovation and clinical studies.

Application

• Research and development of novel nutraceuticals and functional foods targeting cellular health.
• Key ingredient in dietary supplements formulated for antioxidant and anti-inflammatory support.
• Active component in cosmeceutical products for skin health and anti-aging applications.
• Biochemical research tool for studying epigenetic regulation and peptide-mediated biological pathways.
• Development of specialized clinical nutrition products and medical foods.
• Formulation of veterinary health products and animal feed supplements.

Basic Information

Product Name	Lunasin
CAS No.	496823-34-8
Molecular Formula	C₁₈₈H₃₁₇N₅₅O₅₇S
Molecular Weight	~ 5.5 kDa
Synonyms	Soybean Lunasin Peptide; Lunasin Peptide; Bowman-Birk Peptide Lunasin; SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD; Lunasin (soy); 43-mer peptide Lunasin; Lunasin bioactive peptide; Lunasin soy peptide
EINECS	Contact for details

Quality Control

Our Lunasin is produced and tested under strict quality management systems to ensure high purity and batch-to-batch consistency. We provide comprehensive analytical data, including purity by HPLC and peptide content analysis. A Certificate of Analysis (COA) detailing identity, purity, and specific tests is available for every batch to support your quality assurance and regulatory compliance needs.

Storage

Preserve in a tightly closed container, protected from light. Store in a cool, dry place at 2-8°C for long-term stability. This product is hygroscopic (moisture-sensitive) and should be handled under dry conditions to prevent degradation.

Specification

Item	Specification
Appearance	White to off-white powder
Identification (HPLC/MS)	Conforms
Assay (HPLC)	≥ 95.0%
Peptide Content	≥ 80.0%
Water Content (KF)	≤ 5.0%
Residue on Ignition	≤ 1.0%
Heavy Metals	≤ 20 ppm
Microbiological Analysis	Meets standard specifications

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.