Description

Neuropeptide W-30 (Rat) is a synthetic 30-amino acid peptide that functions as an endogenous ligand for the GPR7 and GPR8 receptors. This compound is of significant value for researchers investigating energy homeostasis, stress responses, and neuroendocrine regulation. It is primarily utilized by pharmaceutical R&D teams and academic laboratories focused on neuroscience, metabolic disorders, and central nervous system pharmacology.

Application

• Neuroscience Research: Used as a critical tool for studying the role of the NPBWR1 (GPR7) receptor in the central nervous system.
• Metabolic Disorder Studies: Applied in preclinical research to investigate its effects on food intake, body weight regulation, and energy balance.
• Pharmacological Assay Development: Serves as a reference standard in receptor binding studies and functional cellular assays for drug discovery.
• Endocrine Research: Utilized to explore interactions with stress-related hormones and the hypothalamic-pituitary-adrenal (HPA) axis.
• Biomarker Investigation: Employed in the development of analytical methods (e.g., ELISA, LC-MS) for peptide detection in biological matrices.

Basic Information

Product Name	Neuropeptide W-30 (Rat)
CAS No.	383415-90-5
Molecular Formula	C152H244N46O41S
Molecular Weight	3355.9 g/mol
Synonyms	NPW-30 (Rat); Neuropeptide B/W 30; GPR7 Ligand; NPBWR1 Agonist; Rat Neuropeptide W-30; LPLPQLGNLPWYAGFFMGLVGRPEWWMDYQ; H-Lys-Pro-Leu-Pro-Gln-Leu-Gly-Asn-Leu-Pro-Trp-Tyr-Ala-Gly-Phe-Phe-Met-Gly-Leu-Val-Gly-Arg-Pro-Glu-Trp-Trp-Met-Asp-Tyr-Gln-OH
EINECS	Contact for details

Quality Control

Every batch of Neuropeptide W-30 (Rat) is manufactured under strict quality management systems and undergoes comprehensive analytical characterization. Our products are supplied with a detailed Certificate of Analysis (COA) that includes data for purity (HPLC), peptide content, amino acid analysis, and mass spectrometry (MS) confirmation. We adhere to cGMP guidelines for research-grade peptides to ensure batch-to-batch consistency and reliable performance in your critical experiments.

Storage

Preserve in a tightly closed container, protected from light. Store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). For long-term storage, it is recommended to keep the peptide lyophilized. Avoid repeated freeze-thaw cycles of solutions.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC)	Retention time corresponds to reference standard
Identification (MS)	Molecular weight confirmed by mass spectrometry
Purity (HPLC)	≥ 95%
Peptide Content	≥ 80% (by weight)
Amino Acid Analysis	Within ± 10% of theoretical values
Water Content (KF)	≤ 5.0%
Solubility	Soluble in water, acetic acid, or DMSO

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.