

share
Neuropeptide W-30 (Rat) CAS NO 383415-90-5
Unit Price:
CAS No.:383415-90-5
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
Neuropeptide W-30 (Rat) is a synthetic 30-amino acid peptide that functions as an endogenous ligand for the GPR7 and GPR8 receptors. This compound is of significant value for researchers investigating energy homeostasis, stress responses, and neuroendocrine regulation. It is primarily utilized by pharmaceutical R&D teams and academic laboratories focused on neuroscience, metabolic disorders, and central nervous system pharmacology.
Application
- Neuroscience Research: Used as a critical tool for studying the role of the NPBWR1 (GPR7) receptor in the central nervous system.
- Metabolic Disorder Studies: Applied in preclinical research to investigate its effects on food intake, body weight regulation, and energy balance.
- Pharmacological Assay Development: Serves as a reference standard in receptor binding studies and functional cellular assays for drug discovery.
- Endocrine Research: Utilized to explore interactions with stress-related hormones and the hypothalamic-pituitary-adrenal (HPA) axis.
- Biomarker Investigation: Employed in the development of analytical methods (e.g., ELISA, LC-MS) for peptide detection in biological matrices.
Basic Information
| Product Name | Neuropeptide W-30 (Rat) |
| CAS No. | 383415-90-5 |
| Molecular Formula | C152H244N46O41S |
| Molecular Weight | 3355.9 g/mol |
| Synonyms | NPW-30 (Rat); Neuropeptide B/W 30; GPR7 Ligand; NPBWR1 Agonist; Rat Neuropeptide W-30; LPLPQLGNLPWYAGFFMGLVGRPEWWMDYQ; H-Lys-Pro-Leu-Pro-Gln-Leu-Gly-Asn-Leu-Pro-Trp-Tyr-Ala-Gly-Phe-Phe-Met-Gly-Leu-Val-Gly-Arg-Pro-Glu-Trp-Trp-Met-Asp-Tyr-Gln-OH |
| EINECS | Contact for details |
Quality Control
Every batch of Neuropeptide W-30 (Rat) is manufactured under strict quality management systems and undergoes comprehensive analytical characterization. Our products are supplied with a detailed Certificate of Analysis (COA) that includes data for purity (HPLC), peptide content, amino acid analysis, and mass spectrometry (MS) confirmation. We adhere to cGMP guidelines for research-grade peptides to ensure batch-to-batch consistency and reliable performance in your critical experiments.
Storage
Preserve in a tightly closed container, protected from light. Store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). For long-term storage, it is recommended to keep the peptide lyophilized. Avoid repeated freeze-thaw cycles of solutions.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC) | Retention time corresponds to reference standard |
| Identification (MS) | Molecular weight confirmed by mass spectrometry |
| Purity (HPLC) | ≥ 95% |
| Peptide Content | ≥ 80% (by weight) |
| Amino Acid Analysis | Within ± 10% of theoretical values |
| Water Content (KF) | ≤ 5.0% |
| Solubility | Soluble in water, acetic acid, or DMSO |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


L-Arginine, L-asparaginyl-L-α-glutamyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-valyl-L-prolyl-L-α-aspartyl-L-threonyl-L-lysyl-L-valyl-L-asparaginyl-L-phenylalanyl-L-tyrosyl-L-alanyl-L-tryptophyl-L-lysyl- CAS NO 915091-83-7


Acetyl Octapeptide-1 CAS NO 868844-74-0


N2-(1-Oxohexadecyl)-L-Lysyl-L-Valyl-(2S)-2,4-Diaminobutanoyl-L-Threonine Bis(Trifluoroacetate) (Salt) CAS NO 883558-32-5


Copper Tripeptide CAS NO 89030-95-5


(D-Ala2)-Leu-Enkephalin CAS NO 64963-01-5


Copper Peptide CAS NO 49557-75-7


Orexin A (17-33) CAS NO 343268-91-7


H-Lys-Cys-Asp-Ile-Cys-Thr-Asp-Glu-Tyr-Oh CAS NO 197171-78-1


H-Pro-Leu-Gly-Nh2 CAS NO 2002-44-0


Pinealon CAS NO 175175-23-2


L-Arginine, Glycyl-L-Valyl-L-Seryl-L-Tryptophylglycyl-L-Leucyl- CAS NO 1801959-12-5


Melanotan Ii CAS NO 121062-08-6


Goralatide CAS NO 127103-11-1


H-β-Ala-β-Ala-Oh CAS NO 2140-53-6


α-Msh (11-13) (Free Acid) CAS NO 67727-97-3


Nesiritide Acetate CAS NO 114471-18-0


Tachyplesin CAS NO 118231-04-2


Exendin-4 CAS NO 141758-74-9


L-Serine, N2-(1-Oxotetradecyl)-L-Lysyl-L-Threonyl-L-Threonyl-L-Lysyl- CAS NO 1392416-25-9


Bremelanotide Acetate CAS NO 1607799-13-2
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






