Description

Preptin (Rat) is a synthetic peptide hormone analog with the CAS registry number 315197-73-0. This compound is of significant interest for its role in metabolic research and the study of endocrine signaling pathways. It is primarily utilized by research institutions, pharmaceutical R&D departments, and biotechnology companies engaged in diabetes, obesity, and bone metabolism studies.

Application

• Biomedical Research: Used as a critical reagent in in vitro and in vivo studies to investigate the physiological effects of preptin on insulin secretion, glucose homeostasis, and osteoblast activity.
• Drug Discovery & Development: Serves as a reference standard and a lead compound in screening assays for developing novel therapeutics targeting metabolic disorders.
• Diagnostic Assay Development: Employed in the development and calibration of immunoassays (e.g., ELISA) to detect and quantify preptin levels in biological samples.
• Academic & Institutional Studies: Essential for fundamental research into pancreatic β-cell function, bone formation, and the complex interplay of hormones in metabolic syndrome.
• Peptide Chemistry Studies: Used as a model compound in research focusing on peptide stability, receptor binding affinity, and structure-activity relationships (SAR).

Basic Information

Product Name	Preptin (Rat)
CAS No.	315197-73-0
Molecular Formula	C₁₀₈H₁₆₈N₃₄O₃₄
Molecular Weight	~2460.7 g/mol
Synonyms	Rat Preptin (1-34); Preptin peptide (rat); Preptin (1-34), rat; E1 peptide; Insulin-like growth factor II E-peptide; IGF2E; Proinsulin-like growth factor II E-peptide fragment; Preptin hormone (rat)
EINECS	Contact for details

Quality Control

Our Preptin (Rat) is manufactured under stringent conditions to ensure the highest standards of purity and batch-to-batch consistency, suitable for sensitive research applications. Each lot is accompanied by a comprehensive Certificate of Analysis (COA) detailing purity, peptide content, and analytical results. We adhere to GLP (Good Laboratory Practice) standards in our quality assurance processes to guarantee reliable and reproducible performance in your experiments.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a dry environment before opening to minimize moisture absorption. Aliquot into single-use vials after reconstitution to avoid repeated freeze-thaw cycles.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC & MS)	Conforms to reference standard
Purity (HPLC)	≥ 95%
Peptide Content	≥ 80% (by weight)
Amino Acid Sequence	H-ALKRQPSLPTRLPFLQLLLEGPYTPPPSSGAPPPS-NH₂
Molecular Weight	2460.7 ± 2.0 Da
Single Impurity (HPLC)	≤ 1.0%
Water Content (KF)	≤ 5.0%
Acetate Content (HPLC)	≤ 10.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.