share

Tau Peptide (255-314) (Repeat 2 Domain) CAS NO 2022995-68-0


Unit Price:

CAS No.:2022995-68-0

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

Tau Peptide (255-314) (Repeat 2 Domain) CAS NO 2022995-68-0 is a defined synthetic peptide fragment corresponding to the second microtubule-binding repeat domain of the human tau protein. This high-purity research-grade peptide is critical for studying tau protein aggregation, phosphorylation, and its role in neurodegenerative pathologies. It is an essential biochemical tool for academic, pharmaceutical, and biotechnology researchers focused on Alzheimer's disease, frontotemporal dementia, and other tauopathies.

Application

  • Biochemical Research: Used as a substrate or standard in studies investigating tau protein aggregation kinetics, filament formation, and the molecular mechanisms of neurofibrillary tangle development.
  • Drug Discovery & Screening: Serves as a target molecule in high-throughput assays to identify and validate potential therapeutic compounds that inhibit pathological tau aggregation or promote its clearance.
  • Antibody Development & Validation: Acts as a critical antigen for the production, characterization, and specificity testing of monoclonal and polyclonal antibodies targeting the repeat domain region of tau.
  • Diagnostic Assay Development: Employed in the calibration and development of immunoassays (e.g., ELISA, Western Blot) designed to detect specific tau isoforms or phosphorylated tau species in biological samples.
  • Structural Biology Studies: Utilized in techniques such as NMR spectroscopy and X-ray crystallography to elucidate the three-dimensional structure and conformational dynamics of the tau repeat domain.
  • Cellular & Animal Model Studies: Applied in cell culture and in vivo experiments to model tau pathology and assess the effects of genetic or pharmacological interventions.

Basic Information

Product Name Tau Peptide (255-314) (Repeat 2 Domain)
CAS No. 2022995-68-0
Molecular Formula C265H432N74O81S
Molecular Weight Approx. 5980.9 g/mol
Synonyms Tau Protein Fragment (255-314); Microtubule-Associated Protein Tau (255-314); Tau Repeat Domain 2 Peptide; MAPT (255-314); hTau40 (255-314); Synthetic Tau Peptide; Alzheimer's Disease Research Peptide; Tau Aggregation Peptide
EINECS Contact for details

Quality Control

Every batch of our Tau Peptide (255-314) (Repeat 2 Domain) is synthesized and purified under stringent conditions to ensure the highest standards of identity, purity, and batch-to-batch consistency for research applications. Comprehensive analytical data, including HPLC purity and mass spectrometry (MS) confirmation, is provided. Certificates of Analysis (COA) detailing all quality parameters are available upon request.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake.

Specification

Item Specification
Appearance White to off-white lyophilized powder
Identification (HPLC & MS) Conforms to reference standard
Purity (HPLC) ≥ 95%
Amino Acid Sequence VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
Net Peptide Content ≥ 80%
Water Content (KF) ≤ 5.0%
Single Impurity (HPLC) ≤ 1.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.