Description

H-Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-Nh2 is a high-purity synthetic peptide with the CAS number 235433-36-0, designed for advanced research and development applications. This compound is critical for biochemical studies, particularly in the investigation of protein-protein interactions, enzyme activity, and receptor binding mechanisms. It is primarily utilized by pharmaceutical R&D teams, biotechnology companies, and academic research institutions focused on peptide-based therapeutics and diagnostic tools.

Application

• Biochemical Research: Used as a reference standard or active component in studies of enzymatic processes, signal transduction pathways, and molecular recognition.
• Pharmaceutical Development: Serves as a key intermediate or lead compound in the discovery and optimization of novel peptide-based drugs and biologics.
• Diagnostic Reagent Production: Employed in the formulation of high-sensitivity assay kits, ELISA tests, and other in-vitro diagnostic tools.
• Cell Biology Studies: Applied in cell culture experiments to study the effects of specific peptide sequences on cell proliferation, differentiation, and apoptosis.
• Antibody Production: Acts as an immunogen for generating specific polyclonal or monoclonal antibodies for research and therapeutic use.
• Proteomics & Mass Spectrometry: Utilized as a calibrant or standard in advanced analytical techniques for protein identification and quantification.

Basic Information

Product Name	H-Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-Nh2
CAS No.	235433-36-0
Molecular Formula	C152H245N61O40S
Molecular Weight	~3429.9 g/mol
Synonyms	Peptide 235433-36-0; SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2; H-Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-amide; Custom Peptide 235433-36-0; Synthetic Polypeptide 235433-36-0; Research Peptide CAS 235433-36-0; Biotinylated Peptide (potential derivative); FITC-labeled Peptide (potential derivative)
EINECS	Contact for details

Quality Control

Our H-Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-Nh2 is manufactured under strict quality management systems. Each batch undergoes comprehensive analytical testing, including HPLC for purity, mass spectrometry (MS) for identity confirmation, and amino acid analysis (AAA). Certificates of Analysis (COA) detailing all specifications and test results are provided to ensure traceability and compliance with your research or development protocols.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below in a freezer. For long-term storage, lyophilized powder is recommended. The product is hygroscopic (moisture-sensitive); allow the vial to equilibrate to room temperature before opening to prevent condensation and moisture uptake. Once reconstituted, aliquot and store frozen at -20°C or -80°C to avoid repeated freeze-thaw cycles.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (MS)	Consistent with Molecular Weight
Purity (HPLC)	≥ 95%
Single Impurity (HPLC)	≤ 1.0%
Amino Acid Composition	Within ± 10% of theoretical
Peptide Content	≥ 80%
Water Content (KF)	≤ 5.0%
Acetate Content (HPIC)	≤ 10.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.