Description

Amyloid β-Protein (1-40) Amide is a synthetic peptide fragment corresponding to the N-terminal 1-40 residues of the human amyloid-beta protein, modified with a C-terminal amide group. This peptide is a critical research tool for studying the mechanisms of amyloid fibril formation and neurotoxicity, which are central to Alzheimer's disease pathology. It is essential for scientists and research institutions in the fields of neuroscience, biochemistry, and pharmaceutical development, enabling high-value in vitro and in vivo studies.

Application

• Alzheimer's Disease Research: Primary substrate for studying the aggregation kinetics, structural properties, and toxicity of amyloid-beta peptides.
• Drug Discovery & Screening: Used in high-throughput assays to identify and evaluate potential therapeutic compounds that inhibit fibrillization or promote clearance.
• Biophysical Studies: Essential for techniques like circular dichroism (CD), nuclear magnetic resonance (NMR), and electron microscopy to analyze peptide conformation and aggregation states.
• Antibody & Diagnostic Development: Serves as a key antigen for generating and testing antibodies, and for developing diagnostic assays for amyloid-beta detection.
• Cell Culture & Toxicology: Applied in neuronal cell culture models to investigate peptide-induced cytotoxicity and cellular pathways.
• Biomaterial Science: Used in the engineering of amyloid-based nanomaterials and scaffolds due to its self-assembling properties.

Basic Information

Product Name	Amyloid β-Protein (1-40) Amide
CAS No.	203460-31-5
Molecular Formula	C194H295N55O58S
Molecular Weight	4329.8 g/mol
Synonyms	Amyloid β-Protein (1-40) amide; Aβ(1-40) amide; β-Amyloid (1-40) amide; Amyloid β-Peptide (1-40) amide; DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-NH2; Aβ40 amide; Amyloid-β 1-40 amide
EINECS	Contact for details

Quality Control

Our Amyloid β-Protein (1-40) Amide is manufactured under stringent conditions to ensure the highest standards of purity and batch-to-batch consistency, suitable for sensitive research applications. Each lot undergoes comprehensive analytical characterization, including reversed-phase HPLC, mass spectrometry (MS), and amino acid analysis (AAA). Certificates of Analysis (COA) detailing purity, peptide content, and analytical data are available upon request.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to reach room temperature in a desiccator before opening to prevent condensation and moisture uptake. Aliquot into single-use vials to avoid repeated freeze-thaw cycles.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC & MS)	Conforms to standard
Purity (HPLC)	≥ 95%
Peptide Content	≥ 70%
Molecular Weight (MS)	4329.8 ± 2.0 Da
Solubility	Soluble in water or dilute ammonium hydroxide

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.