Description

H-Cys-Gly-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Glu-Gln-Lys-Cys-Ala-Glu-Cys-Cys-Gly-Gly-Ile-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Asn-Arg-Nh2 is a synthetic peptide of significant interest in advanced biomedical research and therapeutic development. Its complex, cysteine-rich structure makes it a valuable tool for studying protein folding, disulfide bond formation, and specific biological interactions. This high-purity peptide is essential for researchers and developers in the pharmaceutical and biotechnology sectors. It is utilized in applications ranging from drug discovery and target validation to the development of novel peptide-based therapeutics.

Application

• Pharmaceutical Research & Development: Serves as a key intermediate or active pharmaceutical ingredient (API) in the discovery and development of novel peptide-based drugs.
• Biochemical Research: Used as a model compound for studying disulfide bond dynamics, peptide stability, and protein folding pathways in vitro.
• Target Validation & Screening: Employed in high-throughput screening assays and as a ligand to identify and validate specific biological targets or receptors.
• Diagnostic Development: Potential use in the development of diagnostic kits and assays that require specific peptide sequences for biomarker detection.
• Cosmeceutical Applications: Investigated for potential use in advanced skincare formulations targeting specific cellular pathways.
• Academic Research: A critical reagent for universities and research institutes conducting fundamental studies in biochemistry, molecular biology, and medicinal chemistry.

Basic Information

Item	Detail
Product Name	H-Cys-Gly-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Glu-Gln-Lys-Cys-Ala-Glu-Cys-Cys-Gly-Gly-Ile-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Asn-Arg-Nh2
CAS No.	1926163-15-6
Molecular Formula	C149H232N46O45S8
Molecular Weight	~3435.9 g/mol
Synonyms	CAS 1926163-15-6; Cys-Gly-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Glu-Gln-Lys-Cys-Ala-Glu-Cys-Cys-Gly-Gly-Ile-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Asn-Arg-amide; CGPCTTTDHQMEQKCAECCGIGKCYGPQCLCNR-NH2; 34-mer Cysteine-rich Peptide; Synthetic Polypeptide 1926163-15-6; Peptide with CAS 1926163-15-6; Cysteine Cluster Peptide
EINECS	Contact for details

Quality Control

Our H-Cys-Gly-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Glu-Gln-Lys-Cys-Ala-Glu-Cys-Cys-Gly-Gly-Ile-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Asn-Arg-Nh2 is manufactured under strict quality management systems. Each batch undergoes comprehensive analytical testing, including HPLC for purity, MS for identity confirmation, and tests for related substances and residual solvents, ensuring it meets the high standards required for research and development. Certificates of Analysis (COA) detailing all specifications are provided with every shipment.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below for long-term stability. This product is hygroscopic (moisture-sensitive). Allow the vial to reach room temperature in a desiccator before opening to prevent condensation and moisture uptake. For short-term use, store desiccated at 2-8°C.

Specification

Item	Specification
Appearance	White to off-white powder
Identification (HPLC & MS)	Conforms to reference standard
Purity (HPLC)	≥ 95.0%
Single Impurity (HPLC)	≤ 1.0%
Total Impurities (HPLC)	≤ 5.0%
Amino Acid Analysis	Within ±10% of theoretical
Water Content (KF)	≤ 5.0%
Acetate Content (HPLC)	≤ 10.0%
Peptide Content	≥ 70.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.