share

(Arg13)-Amyloid β-Protein (1-40) CAS NO 1816939-33-9


Unit Price:

CAS No.:1816939-33-9

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

(Arg13)-Amyloid β-Protein (1-40) CAS NO 1816939-33-9 is a synthetic, site-specifically modified peptide fragment of the amyloid-beta protein, a key molecule in Alzheimer's disease research. This high-purity, sequence-defined compound is critical for investigating the molecular mechanisms of amyloid aggregation, toxicity, and structure-activity relationships. It is an essential biochemical tool for pharmaceutical R&D, academic neuroscience, and diagnostic development teams focused on neurodegenerative diseases.

Application

  • Biochemical Research: Fundamental studies on amyloid-beta peptide aggregation kinetics, fibril formation, and oligomer toxicity.
  • Drug Discovery & Screening: Used as a target substrate in high-throughput assays to identify and validate potential therapeutic inhibitors of amyloid aggregation.
  • Antibody & Diagnostic Development: Serves as a critical antigen for the production and characterization of site-specific antibodies used in immunoassays and diagnostic kits.
  • Structural Biology: Provides a defined molecular tool for NMR, X-ray crystallography, and other biophysical techniques to elucidate the three-dimensional structure of amyloid variants.
  • Cell-based Assays: Application in cellular models to study peptide-induced cytotoxicity, mitochondrial dysfunction, and synaptic impairment relevant to Alzheimer's pathology.
  • Method Development: Used as a standard or reference material in the development and validation of analytical methods such as HPLC, LC-MS, and capillary electrophoresis for peptide analysis.

Basic Information

Product Name (Arg13)-Amyloid β-Protein (1-40)
CAS No. 1816939-33-9
Molecular Formula C194H295N55O58S
Molecular Weight 4329.8 g/mol
Synonyms Aβ(1-40) R13; Amyloid β-Protein (1-40) Arg13 variant; Aβ1-40 (R13); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV (Arg13); H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH (Arg13); Amyloid β-Peptide (1-40) (human) Arg13; β-Amyloid (1-40), Arg13; CAS 1816939-33-9
EINECS Contact for details

Quality Control

Our (Arg13)-Amyloid β-Protein (1-40) is manufactured under controlled conditions and subjected to rigorous analytical characterization. Each batch is supplied with a comprehensive Certificate of Analysis (COA) detailing purity, identity, and peptide content. Quality is assured through multiple orthogonal methods including HPLC, MS (Mass Spectrometry), and amino acid analysis to ensure sequence fidelity and batch-to-batch consistency for critical research applications.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake. Aliquot into single-use vials to avoid repeated freeze-thaw cycles.

Specification

Item Specification
Appearance White to off-white lyophilized powder
Identification (HPLC) Retention time corresponds to reference standard
Identification (MS) Molecular weight confirmed by mass spectrometry
Purity (HPLC) ≥ 95% (by area at 214 nm)
Peptide Content ≥ 70% (by amino acid analysis)
Solubility Soluble in water, dilute acetic acid, or DMSO

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.