

share
(Arg13)-Amyloid β-Protein (1-40) CAS NO 1816939-33-9
Unit Price:
CAS No.:1816939-33-9
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
(Arg13)-Amyloid β-Protein (1-40) CAS NO 1816939-33-9 is a synthetic, site-specifically modified peptide fragment of the amyloid-beta protein, a key molecule in Alzheimer's disease research. This high-purity, sequence-defined compound is critical for investigating the molecular mechanisms of amyloid aggregation, toxicity, and structure-activity relationships. It is an essential biochemical tool for pharmaceutical R&D, academic neuroscience, and diagnostic development teams focused on neurodegenerative diseases.
Application
- Biochemical Research: Fundamental studies on amyloid-beta peptide aggregation kinetics, fibril formation, and oligomer toxicity.
- Drug Discovery & Screening: Used as a target substrate in high-throughput assays to identify and validate potential therapeutic inhibitors of amyloid aggregation.
- Antibody & Diagnostic Development: Serves as a critical antigen for the production and characterization of site-specific antibodies used in immunoassays and diagnostic kits.
- Structural Biology: Provides a defined molecular tool for NMR, X-ray crystallography, and other biophysical techniques to elucidate the three-dimensional structure of amyloid variants.
- Cell-based Assays: Application in cellular models to study peptide-induced cytotoxicity, mitochondrial dysfunction, and synaptic impairment relevant to Alzheimer's pathology.
- Method Development: Used as a standard or reference material in the development and validation of analytical methods such as HPLC, LC-MS, and capillary electrophoresis for peptide analysis.
Basic Information
| Product Name | (Arg13)-Amyloid β-Protein (1-40) |
| CAS No. | 1816939-33-9 |
| Molecular Formula | C194H295N55O58S |
| Molecular Weight | 4329.8 g/mol |
| Synonyms | Aβ(1-40) R13; Amyloid β-Protein (1-40) Arg13 variant; Aβ1-40 (R13); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV (Arg13); H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH (Arg13); Amyloid β-Peptide (1-40) (human) Arg13; β-Amyloid (1-40), Arg13; CAS 1816939-33-9 |
| EINECS | Contact for details |
Quality Control
Our (Arg13)-Amyloid β-Protein (1-40) is manufactured under controlled conditions and subjected to rigorous analytical characterization. Each batch is supplied with a comprehensive Certificate of Analysis (COA) detailing purity, identity, and peptide content. Quality is assured through multiple orthogonal methods including HPLC, MS (Mass Spectrometry), and amino acid analysis to ensure sequence fidelity and batch-to-batch consistency for critical research applications.
Storage
Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake. Aliquot into single-use vials to avoid repeated freeze-thaw cycles.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC) | Retention time corresponds to reference standard |
| Identification (MS) | Molecular weight confirmed by mass spectrometry |
| Purity (HPLC) | ≥ 95% (by area at 214 nm) |
| Peptide Content | ≥ 70% (by amino acid analysis) |
| Solubility | Soluble in water, dilute acetic acid, or DMSO |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


L-Arginine, L-asparaginyl-L-α-glutamyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-valyl-L-prolyl-L-α-aspartyl-L-threonyl-L-lysyl-L-valyl-L-asparaginyl-L-phenylalanyl-L-tyrosyl-L-alanyl-L-tryptophyl-L-lysyl- CAS NO 915091-83-7


Acetyl Octapeptide-1 CAS NO 868844-74-0


N2-(1-Oxohexadecyl)-L-Lysyl-L-Valyl-(2S)-2,4-Diaminobutanoyl-L-Threonine Bis(Trifluoroacetate) (Salt) CAS NO 883558-32-5


Copper Tripeptide CAS NO 89030-95-5


(D-Ala2)-Leu-Enkephalin CAS NO 64963-01-5


Copper Peptide CAS NO 49557-75-7


Orexin A (17-33) CAS NO 343268-91-7


H-Lys-Cys-Asp-Ile-Cys-Thr-Asp-Glu-Tyr-Oh CAS NO 197171-78-1


H-Pro-Leu-Gly-Nh2 CAS NO 2002-44-0


Pinealon CAS NO 175175-23-2


L-Arginine, Glycyl-L-Valyl-L-Seryl-L-Tryptophylglycyl-L-Leucyl- CAS NO 1801959-12-5


Melanotan Ii CAS NO 121062-08-6


Goralatide CAS NO 127103-11-1


H-β-Ala-β-Ala-Oh CAS NO 2140-53-6


α-Msh (11-13) (Free Acid) CAS NO 67727-97-3


Nesiritide Acetate CAS NO 114471-18-0


Tachyplesin CAS NO 118231-04-2


Exendin-4 CAS NO 141758-74-9


L-Serine, N2-(1-Oxotetradecyl)-L-Lysyl-L-Threonyl-L-Threonyl-L-Lysyl- CAS NO 1392416-25-9


Bremelanotide Acetate CAS NO 1607799-13-2
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






