Description

Biotinyl-Ile-Leu-Gln-Arg-Gly-Ser-Gly-Thr-Ala-Ala-Val-Asp-Phe-Thr-Lys-Lys-Asp-His-Thr-Ala-Thr-Trp-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-Nh2 is a synthetic, biotinylated peptide sequence designed for advanced biochemical and pharmaceutical research. This compound is crucial for applications requiring high-affinity binding and detection, leveraging the strong interaction between biotin and streptavidin. It is primarily utilized by researchers and developers in the fields of proteomics, drug discovery, and diagnostic assay development. The precise sequence offers a targeted tool for studying protein-protein interactions, cell signaling pathways, and as a component in sophisticated bioconjugation strategies.

Application

• Bioconjugation & Probe Development: Serves as a critical linker or tag for attaching proteins, antibodies, or other molecules to solid supports, fluorophores, or enzymes via the biotin-streptavidin system.
• Drug Discovery & Target Validation: Used in high-throughput screening (HTS) assays and as a tool compound to investigate specific biological targets implicated by its peptide sequence.
• Diagnostic Assay Components: Incorporated into ELISA, lateral flow assays, and other immunoassays as a capture or detection element to enhance sensitivity and specificity.
• Affinity Purification: Employed in pull-down assays and chromatography to isolate and purify specific binding partners or complexes from biological samples.
• Cell Biology & Signaling Research: Applied in studies of intracellular pathways, receptor-ligand interactions, and cellular imaging when conjugated to appropriate reporters.
• Peptide-Based Therapeutic Research: Acts as a model compound or a precursor in the development of novel peptide therapeutics and drug delivery systems.

Basic Information

Product Name	Biotinyl-Ile-Leu-Gln-Arg-Gly-Ser-Gly-Thr-Ala-Ala-Val-Asp-Phe-Thr-Lys-Lys-Asp-His-Thr-Ala-Thr-Trp-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-Nh2
CAS No.	1816258-30-6
Molecular Formula	C185H294N58O49S
Molecular Weight	~4168.8 g/mol
Synonyms	Biotin-ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2; Biotinylated Peptide (ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN); Biotin-conjugated Peptide; Biotin-ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN Amide; N-Biotinyl-ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2; Research Peptide; Biotin Labeled Peptide; Synthetic Biotin-Peptide Conjugate
EINECS	Contact for details

Quality Control

Our biotinylated peptides are manufactured under strict quality management systems. Each batch undergoes comprehensive analytical testing, including HPLC for purity verification, MS (Mass Spectrometry) for identity confirmation, and amino acid analysis. We provide full traceability and Certificates of Analysis (COA) detailing all relevant specifications. Production can be aligned with GMP principles for research and development applications requiring the highest standards.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below in a freezer. This product is hygroscopic (moisture-sensitive). For long-term storage, keep the container sealed under an inert atmosphere or desiccated conditions. Allow the vial to warm to room temperature in a desiccator before opening to prevent condensation and moisture uptake.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC & MS)	Conforms to reference standard
Purity (HPLC)	≥ 95%
Assay (Peptide Content)	≥ 80%
Single Impurity (HPLC)	≤ 1.0%
Amino Acid Composition	Within ± 10% of theoretical
Water Content (KF)	≤ 5.0%
Solubility	Soluble in water, DMSO, or aqueous buffers

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.