

share
Biotinyl-Ile-Leu-Gln-Arg-Gly-Ser-Gly-Thr-Ala-Ala-Val-Asp-Phe-Thr-Lys-Lys-Asp-His-Thr-Ala-Thr-Trp-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-Nh2 CAS NO 1816258-30-6
Unit Price:
CAS No.:1816258-30-6
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
Biotinyl-Ile-Leu-Gln-Arg-Gly-Ser-Gly-Thr-Ala-Ala-Val-Asp-Phe-Thr-Lys-Lys-Asp-His-Thr-Ala-Thr-Trp-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-Nh2 is a synthetic, biotinylated peptide sequence designed for advanced biochemical and pharmaceutical research. This compound is crucial for applications requiring high-affinity binding and detection, leveraging the strong interaction between biotin and streptavidin. It is primarily utilized by researchers and developers in the fields of proteomics, drug discovery, and diagnostic assay development. The precise sequence offers a targeted tool for studying protein-protein interactions, cell signaling pathways, and as a component in sophisticated bioconjugation strategies.
Application
- Bioconjugation & Probe Development: Serves as a critical linker or tag for attaching proteins, antibodies, or other molecules to solid supports, fluorophores, or enzymes via the biotin-streptavidin system.
- Drug Discovery & Target Validation: Used in high-throughput screening (HTS) assays and as a tool compound to investigate specific biological targets implicated by its peptide sequence.
- Diagnostic Assay Components: Incorporated into ELISA, lateral flow assays, and other immunoassays as a capture or detection element to enhance sensitivity and specificity.
- Affinity Purification: Employed in pull-down assays and chromatography to isolate and purify specific binding partners or complexes from biological samples.
- Cell Biology & Signaling Research: Applied in studies of intracellular pathways, receptor-ligand interactions, and cellular imaging when conjugated to appropriate reporters.
- Peptide-Based Therapeutic Research: Acts as a model compound or a precursor in the development of novel peptide therapeutics and drug delivery systems.
Basic Information
| Product Name | Biotinyl-Ile-Leu-Gln-Arg-Gly-Ser-Gly-Thr-Ala-Ala-Val-Asp-Phe-Thr-Lys-Lys-Asp-His-Thr-Ala-Thr-Trp-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-Nh2 |
| CAS No. | 1816258-30-6 |
| Molecular Formula | C185H294N58O49S |
| Molecular Weight | ~4168.8 g/mol |
| Synonyms | Biotin-ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2; Biotinylated Peptide (ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN); Biotin-conjugated Peptide; Biotin-ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN Amide; N-Biotinyl-ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2; Research Peptide; Biotin Labeled Peptide; Synthetic Biotin-Peptide Conjugate |
| EINECS | Contact for details |
Quality Control
Our biotinylated peptides are manufactured under strict quality management systems. Each batch undergoes comprehensive analytical testing, including HPLC for purity verification, MS (Mass Spectrometry) for identity confirmation, and amino acid analysis. We provide full traceability and Certificates of Analysis (COA) detailing all relevant specifications. Production can be aligned with GMP principles for research and development applications requiring the highest standards.
Storage
Preserve in a tightly closed container, protected from light. Store at -20°C or below in a freezer. This product is hygroscopic (moisture-sensitive). For long-term storage, keep the container sealed under an inert atmosphere or desiccated conditions. Allow the vial to warm to room temperature in a desiccator before opening to prevent condensation and moisture uptake.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC & MS) | Conforms to reference standard |
| Purity (HPLC) | ≥ 95% |
| Assay (Peptide Content) | ≥ 80% |
| Single Impurity (HPLC) | ≤ 1.0% |
| Amino Acid Composition | Within ± 10% of theoretical |
| Water Content (KF) | ≤ 5.0% |
| Solubility | Soluble in water, DMSO, or aqueous buffers |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


Trichophytin CAS NO 1404-86-0


Acetylthiocholine Iodide CAS NO 1866-15-5


R-Phycoerythrin CAS NO 11016-17-4


Brucellin CAS NO 11028-17-4


Lipostabil CAS NO 11096-62-1


Coccidioidin CAS NO 12622-73-0


Flagellin CAS NO 12777-81-0


Nitro Blue Tetrazolium Formazan CAS NO 16325-01-2


Copper Pyruvaldehyde Bis(N(4)-Methylthiosemicarbazone) Complex CAS NO 19976-14-8


Hemoglobin Poissy CAS NO 100356-93-2


n-Methyl-9-(p-Chlorophenoxycarbonyl)-Acridinium Iodide) CAS NO 100733-12-8


Benzenepropanamide, 4-Hydroxy-3-(Iodo-125I)-n-(5-((2-(((4-Methoxypheny L)Methyl)-2-Pyridinylamino)Ethyl)Methylamino)Pentyl)- CAS NO 101395-33-9


Hemoglobin A2 Honai CAS NO 101800-48-0


n-(3-Sulfopropyl)-3,3',5,5'-Tetramethylbenzidine Sodium Salt CAS NO 102062-36-2


p-Nh2-Bn-Dtpa(B-300) CAS NO 102650-29-3


Aminobutylethylisoluminol-Biotin CAS NO 103612-64-2


Protein 61, Varicella-Zoster Virus CAS NO 106121-63-5


(3,4,4-Trimethyl-1,2-Dioxetan-3-Yl)Methyl 4-Pyridinylcarbamate CAS NO 107323-99-9


3-Indoxyl Phosphate, Bis(2-Amino-2-Methyl-1,3-Propanediol) Salt CAS NO 107475-12-7


Spike Glycoprotein, Coronavirus CAS NO 107476-75-5
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






