Description

Biotinyl-εahx-Amyloid β-Protein (1-40) CAS NO 1802086-72-1 is a biotinylated, chemically modified peptide fragment derived from the amyloid beta protein, a key molecule in Alzheimer's disease research. This compound is engineered for high-affinity binding in detection and capture assays, providing superior sensitivity and specificity. It is an essential reagent for researchers and diagnostic developers in neuroscience, pharmaceutical discovery, and biomarker analysis.

Application

• Development and validation of immunoassays (ELISA, Western Blot) for amyloid beta detection.
• As a critical capture or detection probe in biosensor platforms for Alzheimer's disease biomarker research.
• Use in affinity purification systems to isolate specific antibodies or interacting proteins.
• Conjugation to surfaces or beads for protein-protein interaction studies and pull-down assays.
• Key component in diagnostic kit development targeting amyloid beta aggregates.
• High-sensitivity histological staining and imaging applications in brain tissue samples.
• Calibration and standardization of analytical instruments in clinical research laboratories.

Basic Information

Product Name	Biotinyl-εahx-Amyloid β-Protein (1-40)
CAS No.	1802086-72-1
Molecular Formula	Contact for details
Molecular Weight	Contact for details
Synonyms	Biotin-Ahx-Amyloid β (1-40); Biotin-6-Aminohexanoic Acid-Amyloid Beta Protein (1-40); Aβ (1-40) Biotin Conjugate; Biotinylated Amyloid Beta 1-40; Biotin-Ahx-Aβ1-40; Biotin-Ahx-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
EINECS	Contact for details

Quality Control

Our Biotinyl-εahx-Amyloid β-Protein (1-40) is produced under stringent conditions to ensure batch-to-batch consistency and high biological activity. Quality is verified through a comprehensive suite of analytical techniques including HPLC for purity and MS for identity confirmation. A Certificate of Analysis (COA) detailing purity, concentration, and performance data is provided with every shipment to support your research and regulatory needs.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a dry environment before opening to prevent condensation and moisture uptake.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (MS)	Conforms to structure
Purity (HPLC)	≥ 95%
Peptide Content	≥ 80%
Solubility	Soluble in water or DMSO
Biological Activity	Confirmed by binding assay

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.