share

Biotinyl-εahx-Amyloid β-Protein (1-40) CAS NO 1802086-72-1


Unit Price:

CAS No.:1802086-72-1

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

Biotinyl-εahx-Amyloid β-Protein (1-40) CAS NO 1802086-72-1 is a biotinylated, chemically modified peptide fragment derived from the amyloid beta protein, a key molecule in Alzheimer's disease research. This compound is engineered for high-affinity binding in detection and capture assays, providing superior sensitivity and specificity. It is an essential reagent for researchers and diagnostic developers in neuroscience, pharmaceutical discovery, and biomarker analysis.

Application

  • Development and validation of immunoassays (ELISA, Western Blot) for amyloid beta detection.
  • As a critical capture or detection probe in biosensor platforms for Alzheimer's disease biomarker research.
  • Use in affinity purification systems to isolate specific antibodies or interacting proteins.
  • Conjugation to surfaces or beads for protein-protein interaction studies and pull-down assays.
  • Key component in diagnostic kit development targeting amyloid beta aggregates.
  • High-sensitivity histological staining and imaging applications in brain tissue samples.
  • Calibration and standardization of analytical instruments in clinical research laboratories.

Basic Information

Product Name Biotinyl-εahx-Amyloid β-Protein (1-40)
CAS No. 1802086-72-1
Molecular Formula Contact for details
Molecular Weight Contact for details
Synonyms Biotin-Ahx-Amyloid β (1-40); Biotin-6-Aminohexanoic Acid-Amyloid Beta Protein (1-40); Aβ (1-40) Biotin Conjugate; Biotinylated Amyloid Beta 1-40; Biotin-Ahx-Aβ1-40; Biotin-Ahx-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
EINECS Contact for details

Quality Control

Our Biotinyl-εahx-Amyloid β-Protein (1-40) is produced under stringent conditions to ensure batch-to-batch consistency and high biological activity. Quality is verified through a comprehensive suite of analytical techniques including HPLC for purity and MS for identity confirmation. A Certificate of Analysis (COA) detailing purity, concentration, and performance data is provided with every shipment to support your research and regulatory needs.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a dry environment before opening to prevent condensation and moisture uptake.

Specification

Item Specification
Appearance White to off-white lyophilized powder
Identification (MS) Conforms to structure
Purity (HPLC) ≥ 95%
Peptide Content ≥ 80%
Solubility Soluble in water or DMSO
Biological Activity Confirmed by binding assay

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.