Description

(Nle3)-Amyloid β-Protein (1-40) Ammonium Salt is a high-purity, chemically modified peptide analog of the amyloid beta protein fragment, designed for advanced biochemical and pharmaceutical research. This compound is critical for studying the mechanisms of amyloid aggregation and neurotoxicity, which are central to Alzheimer's disease research and therapeutic development. It is an essential reagent for academic institutions, biotechnology firms, and pharmaceutical companies engaged in neuroscience, drug discovery, and diagnostic assay development.

Application

• Alzheimer's Disease Research: Used as a key substrate in studies investigating amyloid-beta aggregation kinetics, fibril formation, and neurotoxic effects.
• Drug Discovery & Screening: Serves as a target molecule in high-throughput screening (HTS) assays to identify potential inhibitors of amyloid-beta aggregation.
• Biophysical Studies: Employed in techniques like circular dichroism (CD), nuclear magnetic resonance (NMR), and surface plasmon resonance (SPR) to analyze peptide structure and interactions.
• Antibody & Diagnostic Development: Acts as an antigen for the production and validation of antibodies used in ELISA, Western blot, and other immunoassays for Alzheimer's biomarkers.
• Cell Culture & Toxicology: Applied in cellular models to study peptide-induced cytotoxicity and mechanisms of neuronal cell death.
• Method Development & Validation: Used as a reference standard in the development and qualification of analytical methods (e.g., HPLC, LC-MS) for peptide quantification and purity assessment.

Basic Information

Product Name	(Nle3)-Amyloid β-Protein (1-40) Ammonium Salt
CAS No.	1802086-31-2
Molecular Formula	C203H311N57O60S • xNH3
Molecular Weight	~4330.1 g/mol (free acid, average)
Synonyms	Norleucine3-Amyloid β-Protein (1-40); Aβ(1-40) (Nle3); Amyloid Beta Peptide (1-40) (Nle3) ammonium salt; DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV(Nle3); Modified Amyloid-β (1-40); Aβ1-40 analog; Research peptide 1802086-31-2
EINECS	Contact for details

Quality Control

Every batch of (Nle3)-Amyloid β-Protein (1-40) Ammonium Salt is manufactured and analyzed under strict quality management systems. We guarantee high purity and batch-to-batch consistency through comprehensive analytical techniques including HPLC, MS, and amino acid analysis. A detailed Certificate of Analysis (COA) providing purity, peptide content, and analytical data is supplied with each shipment to ensure compliance with your research and development requirements.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive) and easily oxidized; it is recommended to store under an inert atmosphere after opening and to allow the vial to equilibrate to room temperature before opening to minimize moisture condensation.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC/MS)	Conforms to reference standard
Purity (HPLC)	≥ 95%
Peptide Content	≥ 70% (by weight)
Amino Acid Analysis	Within ± 10% of theoretical
Solubility	Soluble in water or dilute aqueous acetic acid
Single Peak on HPLC	Present

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.