

share
(Nle3)-Amyloid β-Protein (1-40) Ammonium Salt CAS NO 1802086-31-2
Unit Price:
CAS No.:1802086-31-2
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
(Nle3)-Amyloid β-Protein (1-40) Ammonium Salt is a high-purity, chemically modified peptide analog of the amyloid beta protein fragment, designed for advanced biochemical and pharmaceutical research. This compound is critical for studying the mechanisms of amyloid aggregation and neurotoxicity, which are central to Alzheimer's disease research and therapeutic development. It is an essential reagent for academic institutions, biotechnology firms, and pharmaceutical companies engaged in neuroscience, drug discovery, and diagnostic assay development.
Application
- Alzheimer's Disease Research: Used as a key substrate in studies investigating amyloid-beta aggregation kinetics, fibril formation, and neurotoxic effects.
- Drug Discovery & Screening: Serves as a target molecule in high-throughput screening (HTS) assays to identify potential inhibitors of amyloid-beta aggregation.
- Biophysical Studies: Employed in techniques like circular dichroism (CD), nuclear magnetic resonance (NMR), and surface plasmon resonance (SPR) to analyze peptide structure and interactions.
- Antibody & Diagnostic Development: Acts as an antigen for the production and validation of antibodies used in ELISA, Western blot, and other immunoassays for Alzheimer's biomarkers.
- Cell Culture & Toxicology: Applied in cellular models to study peptide-induced cytotoxicity and mechanisms of neuronal cell death.
- Method Development & Validation: Used as a reference standard in the development and qualification of analytical methods (e.g., HPLC, LC-MS) for peptide quantification and purity assessment.
Basic Information
| Product Name | (Nle3)-Amyloid β-Protein (1-40) Ammonium Salt |
| CAS No. | 1802086-31-2 |
| Molecular Formula | C203H311N57O60S • xNH3 |
| Molecular Weight | ~4330.1 g/mol (free acid, average) |
| Synonyms | Norleucine3-Amyloid β-Protein (1-40); Aβ(1-40) (Nle3); Amyloid Beta Peptide (1-40) (Nle3) ammonium salt; DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV(Nle3); Modified Amyloid-β (1-40); Aβ1-40 analog; Research peptide 1802086-31-2 |
| EINECS | Contact for details |
Quality Control
Every batch of (Nle3)-Amyloid β-Protein (1-40) Ammonium Salt is manufactured and analyzed under strict quality management systems. We guarantee high purity and batch-to-batch consistency through comprehensive analytical techniques including HPLC, MS, and amino acid analysis. A detailed Certificate of Analysis (COA) providing purity, peptide content, and analytical data is supplied with each shipment to ensure compliance with your research and development requirements.
Storage
Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive) and easily oxidized; it is recommended to store under an inert atmosphere after opening and to allow the vial to equilibrate to room temperature before opening to minimize moisture condensation.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC/MS) | Conforms to reference standard |
| Purity (HPLC) | ≥ 95% |
| Peptide Content | ≥ 70% (by weight) |
| Amino Acid Analysis | Within ± 10% of theoretical |
| Solubility | Soluble in water or dilute aqueous acetic acid |
| Single Peak on HPLC | Present |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


L-Arginine, L-asparaginyl-L-α-glutamyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-valyl-L-prolyl-L-α-aspartyl-L-threonyl-L-lysyl-L-valyl-L-asparaginyl-L-phenylalanyl-L-tyrosyl-L-alanyl-L-tryptophyl-L-lysyl- CAS NO 915091-83-7


Acetyl Octapeptide-1 CAS NO 868844-74-0


N2-(1-Oxohexadecyl)-L-Lysyl-L-Valyl-(2S)-2,4-Diaminobutanoyl-L-Threonine Bis(Trifluoroacetate) (Salt) CAS NO 883558-32-5


Copper Tripeptide CAS NO 89030-95-5


(D-Ala2)-Leu-Enkephalin CAS NO 64963-01-5


Copper Peptide CAS NO 49557-75-7


Orexin A (17-33) CAS NO 343268-91-7


H-Lys-Cys-Asp-Ile-Cys-Thr-Asp-Glu-Tyr-Oh CAS NO 197171-78-1


H-Pro-Leu-Gly-Nh2 CAS NO 2002-44-0


Pinealon CAS NO 175175-23-2


L-Arginine, Glycyl-L-Valyl-L-Seryl-L-Tryptophylglycyl-L-Leucyl- CAS NO 1801959-12-5


Melanotan Ii CAS NO 121062-08-6


Goralatide CAS NO 127103-11-1


H-β-Ala-β-Ala-Oh CAS NO 2140-53-6


α-Msh (11-13) (Free Acid) CAS NO 67727-97-3


Nesiritide Acetate CAS NO 114471-18-0


Tachyplesin CAS NO 118231-04-2


Exendin-4 CAS NO 141758-74-9


L-Serine, N2-(1-Oxotetradecyl)-L-Lysyl-L-Threonyl-L-Threonyl-L-Lysyl- CAS NO 1392416-25-9


Bremelanotide Acetate CAS NO 1607799-13-2
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






