share

(Gln)-Amyloid β-Protein (1-40) CAS NO 1802084-59-8


Unit Price:

CAS No.:1802084-59-8

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

(Gln)-Amyloid β-Protein (1-40) CAS NO 1802084-59-8 is a synthetic peptide fragment corresponding to a specific isoform of the amyloid-beta protein, a key molecule in Alzheimer's disease research. This high-purity, sequence-defined peptide is critical for advancing the understanding of protein aggregation mechanisms and neurotoxicity. It is an essential biochemical tool for researchers and developers in neuroscience, pharmaceutical R&D, and diagnostic assay development, providing a reliable standard for studying disease pathology and screening potential therapeutics.

Application

  • Biomedical Research: Fundamental studies on the aggregation kinetics, structure, and toxicity of amyloid-beta peptides in Alzheimer's disease models.
  • Drug Discovery & Screening: Used as a target or reference standard in high-throughput assays to identify and validate potential inhibitors of amyloid-beta aggregation.
  • Antibody Development & Validation: Serves as a critical antigen for the production, characterization, and quality control of diagnostic and therapeutic antibodies targeting amyloid-beta.
  • Diagnostic Assay Calibration: Acts as a precise calibrator and control material in ELISA, Western Blot, and other immunoassays for detecting amyloid-beta isoforms in biological samples.
  • Biophysical Studies: Utilized in techniques like NMR, CD spectroscopy, and electron microscopy to elucidate the secondary and tertiary structure of amyloid-beta variants.
  • Cell Culture & In Vitro Models: Applied to neuronal cell cultures to induce and study amyloid-β-mediated cytotoxicity and cellular pathways.

Basic Information

Product Name (Gln)-Amyloid β-Protein (1-40)
CAS No. 1802084-59-8
Molecular Formula C194H295N55O60S
Molecular Weight 4329.8 g/mol
Synonyms Abeta (1-40) Gln; Aβ (1-40) Gln; Amyloid β-Protein (1-40) Glutamine variant; DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV (Gln15); Amyloid β-Peptide (1-40) (human) Gln15; β-Amyloid Peptide (1-40) Gln; pGlu-Aβ(1-40)
EINECS Contact for details

Quality Control

Every batch of (Gln)-Amyloid β-Protein (1-40) is manufactured under controlled conditions and undergoes rigorous analytical characterization to ensure identity, purity, and batch-to-batch consistency. Our quality system is designed to support research reproducibility. Comprehensive Certificates of Analysis (COA) detailing purity by HPLC, mass spectrometry (MS) confirmation, and endotoxin levels are provided with each shipment.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to reach room temperature in a desiccator before opening to prevent condensation and hydrolysis. Aliquot into single-use vials after reconstitution to avoid repeated freeze-thaw cycles.

Specification

Item Specification
Appearance White to off-white lyophilized powder
Identification (MS) Consistent with theoretical molecular weight
Purity (HPLC) ≥ 95%
Peptide Content ≥ 70% (by weight)
Amino Acid Analysis Within ± 10% of theoretical composition
Water Content (KF) ≤ 5.0%
Endotoxin Level < 10 EU/mg
Solubility Soluble in water, DMSO, or dilute aqueous acetic acid

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.