Description

Amyloid Dan Protein (1-34) (Reduced) is a synthetic peptide fragment corresponding to a specific region of the amyloid protein, provided in its reduced (non-oxidized) form. This high-purity biochemical is critical for advanced research into protein aggregation mechanisms and neurodegenerative disease pathology. It serves as an essential reference standard and active research component for pharmaceutical R&D, academic institutions, and diagnostic developers focused on Alzheimer's disease and related conditions.

Application

• Neuroscience Research: Fundamental studies on amyloid beta peptide aggregation kinetics, oligomer formation, and neurotoxicity.
• Drug Discovery & Screening: Target molecule for in vitro and in vivo assays to evaluate potential therapeutic compounds that inhibit aggregation or promote clearance.
• Diagnostic Development: Key antigen for the production and calibration of antibodies used in immunoassays (ELISA, Western Blot) and imaging probes.
• Biophysical Studies: Utilization in structural analysis via NMR, X-ray crystallography, and spectroscopy to understand folding and interaction dynamics.
• Toxicology & Mechanism of Action: Investigation of cellular pathways affected by amyloid peptides and their role in disease progression.
• Reference Standard: Certified material for quality control and validation in research and diagnostic manufacturing processes.

Basic Information

Product Name	Amyloid Dan Protein (1-34) (Reduced)
CAS No.	1802083-00-6
Molecular Formula	Contact for details
Molecular Weight	Contact for details
Synonyms	Amyloid β-Protein (1-34), reduced; Aβ(1-34), reduced; Amyloid Beta Peptide (1-34) (Reduced); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLM (reduced); β-Amyloid Peptide 1-34 (Reduced); Amyloid Dan (1-34); Synthetic Amyloid Peptide Fragment
EINECS	Contact for details

Quality Control

Our Amyloid Dan Protein (1-34) (Reduced) is manufactured under strict controls to ensure the highest standards of purity and batch-to-batch consistency, suitable for sensitive research applications. Each lot is accompanied by a comprehensive Certificate of Analysis (COA) detailing purity (typically >95% by HPLC), peptide content, and results from mass spectrometry (MS) analysis for identity confirmation. We adhere to quality management principles aligned with ISO standards to support our global clientele in pharmaceutical and academic research.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below in a freezer. This product is hygroscopic (moisture-sensitive); allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and hydrolysis. For long-term stability, store under inert atmosphere where possible.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (MS)	Conforms to structure
Purity (HPLC)	≥ 95%
Peptide Content	≥ 80%
Solubility	Soluble in water or dilute acetic acid

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.