

share
β-Amyloid (1-38), Mouse, Rat CAS NO 186359-66-0
Unit Price:
CAS No.:186359-66-0
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
β-Amyloid (1-38), Mouse, Rat is a synthetic peptide fragment corresponding to amino acids 1-38 of the amyloid-beta protein found in murine and rat models. This compound is a critical research tool for studying the mechanisms of amyloidogenesis, neurotoxicity, and Alzheimer's disease pathology in preclinical rodent systems. It is essential for neuroscientists, pharmacologists, and biotechnology researchers focused on developing and validating therapeutic interventions and diagnostic assays.
Application
- Neuroscience Research: Fundamental studies on amyloid-beta aggregation kinetics, oligomer formation, and fibrillogenesis in rodent-specific contexts.
- Drug Discovery & Screening: Used as a target substrate in high-throughput assays to identify and evaluate potential inhibitors of Aβ aggregation for Alzheimer's disease therapeutics.
- Antibody & Assay Development: Critical for the production, characterization, and validation of specific antibodies, ELISA kits, and other immunoassays designed for rodent Aβ species.
- Toxicology Studies: Investigation of the neurotoxic effects of Aβ(1-38) fragments on primary neuronal cultures or brain slices from mouse and rat models.
- Biophysical Characterization: Analysis of peptide structure, stability, and interaction with membranes or other biomolecules using techniques like circular dichroism (CD) and surface plasmon resonance (SPR).
- Animal Model Studies: Administration in vivo to induce or model aspects of amyloid pathology in transgenic or wild-type rodents.
Basic Information
| Product Name | β-Amyloid (1-38), Mouse, Rat |
| CAS No. | 186359-66-0 |
| Molecular Formula | C185H283N53O58S |
| Molecular Weight | 4134.6 g/mol |
| Synonyms | Amyloid Beta Peptide (1-38), mouse/rat; Aβ (1-38); Amyloid β-Protein (1-38); β-Amyloid (1-38); Amyloid β (1-38); APP (1-38); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| EINECS | Contact for details |
Quality Control
Our β-Amyloid (1-38), Mouse, Rat is manufactured under stringent conditions to ensure the highest standards of identity, purity, and batch-to-batch consistency, suitable for sensitive research applications. Each lot is supported by a comprehensive Certificate of Analysis (COA) detailing purity by HPLC, peptide content, and molecular mass verification. We adhere to quality management principles aligned with ISO standards to guarantee reliable and reproducible performance in your experiments.
Storage
Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to warm to room temperature in a desiccator before opening to prevent condensation and moisture uptake. Aliquot into single-use quantities to avoid repeated freeze-thaw cycles.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC & MS) | Conforms to reference standard |
| Purity (HPLC) | ≥ 95% |
| Peptide Content | ≥ 70% (by weight) |
| Molecular Weight | 4134.6 ± 2.0 Da (MALDI-TOF MS) |
| Solubility | Soluble in 1% acetic acid or DMSO |
| Endotoxin Level | < 1.0 EU/mg |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


L-Arginine, L-asparaginyl-L-α-glutamyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-valyl-L-prolyl-L-α-aspartyl-L-threonyl-L-lysyl-L-valyl-L-asparaginyl-L-phenylalanyl-L-tyrosyl-L-alanyl-L-tryptophyl-L-lysyl- CAS NO 915091-83-7


Acetyl Octapeptide-1 CAS NO 868844-74-0


N2-(1-Oxohexadecyl)-L-Lysyl-L-Valyl-(2S)-2,4-Diaminobutanoyl-L-Threonine Bis(Trifluoroacetate) (Salt) CAS NO 883558-32-5


Copper Tripeptide CAS NO 89030-95-5


(D-Ala2)-Leu-Enkephalin CAS NO 64963-01-5


Copper Peptide CAS NO 49557-75-7


Orexin A (17-33) CAS NO 343268-91-7


H-Lys-Cys-Asp-Ile-Cys-Thr-Asp-Glu-Tyr-Oh CAS NO 197171-78-1


H-Pro-Leu-Gly-Nh2 CAS NO 2002-44-0


Pinealon CAS NO 175175-23-2


L-Arginine, Glycyl-L-Valyl-L-Seryl-L-Tryptophylglycyl-L-Leucyl- CAS NO 1801959-12-5


Melanotan Ii CAS NO 121062-08-6


Goralatide CAS NO 127103-11-1


H-β-Ala-β-Ala-Oh CAS NO 2140-53-6


α-Msh (11-13) (Free Acid) CAS NO 67727-97-3


Nesiritide Acetate CAS NO 114471-18-0


Tachyplesin CAS NO 118231-04-2


Exendin-4 CAS NO 141758-74-9


L-Serine, N2-(1-Oxotetradecyl)-L-Lysyl-L-Threonyl-L-Threonyl-L-Lysyl- CAS NO 1392416-25-9


Bremelanotide Acetate CAS NO 1607799-13-2
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






