share

β-Amyloid (1-38), Mouse, Rat CAS NO 186359-66-0


Unit Price:

CAS No.:186359-66-0

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

β-Amyloid (1-38), Mouse, Rat is a synthetic peptide fragment corresponding to amino acids 1-38 of the amyloid-beta protein found in murine and rat models. This compound is a critical research tool for studying the mechanisms of amyloidogenesis, neurotoxicity, and Alzheimer's disease pathology in preclinical rodent systems. It is essential for neuroscientists, pharmacologists, and biotechnology researchers focused on developing and validating therapeutic interventions and diagnostic assays.

Application

  • Neuroscience Research: Fundamental studies on amyloid-beta aggregation kinetics, oligomer formation, and fibrillogenesis in rodent-specific contexts.
  • Drug Discovery & Screening: Used as a target substrate in high-throughput assays to identify and evaluate potential inhibitors of Aβ aggregation for Alzheimer's disease therapeutics.
  • Antibody & Assay Development: Critical for the production, characterization, and validation of specific antibodies, ELISA kits, and other immunoassays designed for rodent Aβ species.
  • Toxicology Studies: Investigation of the neurotoxic effects of Aβ(1-38) fragments on primary neuronal cultures or brain slices from mouse and rat models.
  • Biophysical Characterization: Analysis of peptide structure, stability, and interaction with membranes or other biomolecules using techniques like circular dichroism (CD) and surface plasmon resonance (SPR).
  • Animal Model Studies: Administration in vivo to induce or model aspects of amyloid pathology in transgenic or wild-type rodents.

Basic Information

Product Name β-Amyloid (1-38), Mouse, Rat
CAS No. 186359-66-0
Molecular Formula C185H283N53O58S
Molecular Weight 4134.6 g/mol
Synonyms Amyloid Beta Peptide (1-38), mouse/rat; Aβ (1-38); Amyloid β-Protein (1-38); β-Amyloid (1-38); Amyloid β (1-38); APP (1-38); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
EINECS Contact for details

Quality Control

Our β-Amyloid (1-38), Mouse, Rat is manufactured under stringent conditions to ensure the highest standards of identity, purity, and batch-to-batch consistency, suitable for sensitive research applications. Each lot is supported by a comprehensive Certificate of Analysis (COA) detailing purity by HPLC, peptide content, and molecular mass verification. We adhere to quality management principles aligned with ISO standards to guarantee reliable and reproducible performance in your experiments.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to warm to room temperature in a desiccator before opening to prevent condensation and moisture uptake. Aliquot into single-use quantities to avoid repeated freeze-thaw cycles.

Specification

Item Specification
Appearance White to off-white lyophilized powder
Identification (HPLC & MS) Conforms to reference standard
Purity (HPLC) ≥ 95%
Peptide Content ≥ 70% (by weight)
Molecular Weight 4134.6 ± 2.0 Da (MALDI-TOF MS)
Solubility Soluble in 1% acetic acid or DMSO
Endotoxin Level < 1.0 EU/mg

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.