share

β- Amyloid (1-34) CAS NO 186359-65-9


Unit Price:

CAS No.:186359-65-9

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

β-Amyloid (1-34) is a synthetic peptide fragment corresponding to amino acids 1-34 of the human amyloid-beta protein. This compound is a critical research tool for studying the mechanisms of amyloid plaque formation, a hallmark of Alzheimer's disease and other neurodegenerative conditions. It is essential for scientists and pharmaceutical developers in neuroscience research, drug discovery, and diagnostic assay development, providing a defined substrate for aggregation studies, toxicity assays, and antibody characterization.

Application

  • Biomedical Research: Fundamental studies on the aggregation kinetics, structure, and neurotoxicity of amyloid-beta peptides.
  • Drug Discovery Screening: Used as a target substrate in high-throughput assays to identify and validate potential therapeutic inhibitors of amyloid aggregation.
  • Antibody Development & Validation: Serves as a key antigen for the production, testing, and calibration of diagnostic and therapeutic antibodies targeting amyloid-beta.
  • In Vitro Model Systems: Employed to create synthetic amyloid fibrils or oligomers for cell culture studies modeling neuronal toxicity.
  • Biophysical Characterization: Analysis of peptide secondary structure (e.g., via CD spectroscopy, FTIR) and fibril morphology (e.g., via electron microscopy).
  • Diagnostic Kit Development: A component in the development of ELISA and other immunoassays for detecting amyloid-beta variants in biological samples.

Basic Information

Product Name β-Amyloid (1-34)
CAS No. 186359-65-9
Molecular Formula C165H250N44O48S
Molecular Weight 3652.1 g/mol
Synonyms Amyloid β-Protein (1-34); Aβ (1-34); β-Amyloid (1-34); Amyloid β-Peptide (1-34); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLM; Aβ1-34; Amyloid-β (1-34) fragment
EINECS Contact for details

Quality Control

Our β-Amyloid (1-34) is produced under stringent conditions to ensure batch-to-batch consistency and high biological activity. Quality is verified through a comprehensive suite of analytical techniques, including HPLC for purity assessment and MS for identity confirmation. Our products undergo rigorous quality testing to ensure compliance with industry standards. Certificates of Analysis (COA) with detailed chromatographic and spectroscopic data are available upon request.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and hydrolysis.

Specification

Item Specification
Appearance White to off-white lyophilized powder
Identification (MS) Consistent with theoretical molecular weight
Purity (HPLC) ≥ 95%
Peptide Content ≥ 70% (by weight)
Solubility Soluble in water or dilute aqueous acetic acid

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.