

share
Urocortin (Human) CAS NO 176591-49-4
Unit Price:
CAS No.:176591-49-4
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
Urocortin (Human) is a synthetic 40-amino acid peptide belonging to the corticotropin-releasing factor (CRF) family, with the CAS registry number 176591-49-4. This biologically active neuropeptide is a critical research tool for studying stress response, cardiovascular function, and energy homeostasis pathways. It is essential for pharmaceutical R&D, academic research, and diagnostic development in the fields of neuroscience, endocrinology, and cardiology.
Application
- Neuroscience Research: Used as a standard or reagent in studies investigating the central nervous system's response to stress, anxiety, and depression.
- Cardiovascular Research: Employed in preclinical models to study its vasodilatory and cardioprotective effects, including potential therapeutic applications for heart failure.
- Endocrinology Studies: Serves as a key ligand for CRF receptor binding assays and signal transduction research related to the hypothalamic-pituitary-adrenal (HPA) axis.
- Pharmaceutical Development: Acts as a reference standard in the discovery and validation of novel therapeutics targeting CRF receptors for metabolic and psychiatric disorders.
- Diagnostic Kit Manufacturing: Utilized as a calibrated antigen or standard in the production of immunoassay kits for research and clinical testing.
- Cell Biology & Signal Transduction: Applied in in vitro cell culture studies to examine cellular responses and receptor activation mechanisms.
Basic Information
| Product Name | Urocortin (Human) |
| CAS No. | 176591-49-4 |
| Molecular Formula | C198H310N56O58S |
| Molecular Weight | 4428.1 g/mol |
| Synonyms | Human Urocortin; Urocortin I (Human); UCN; UCN1; Urocortin-1; hUCN; Stresscopin; Corticotropin-Releasing Factor 2 (CRF2) Ligand; 40AA Peptide (hUCN); DDPFLSIILTLTPNKNENNNFQILFQKCRFQHNSEIKIRSNMELNA |
| EINECS | Contact for details |
Quality Control
Our Urocortin (Human) is manufactured under strict quality systems. Each batch undergoes comprehensive analytical testing, including HPLC for purity and identity verification, mass spectrometry for molecular weight confirmation, and rigorous testing for endotoxins and residual solvents. A comprehensive Certificate of Analysis (COA) detailing purity, peptide content, and analytical data is provided with every shipment to ensure traceability and compliance with research-grade standards.
Storage
Preserve in a tightly closed container, protected from light. For long-term stability, store lyophilized powder at -20°C or below. Once reconstituted, aliquot and store solutions at -70°C to -80°C to prevent degradation. Avoid repeated freeze-thaw cycles. This product is hygroscopic (moisture-sensitive).
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC/MS) | Conforms to reference standard |
| Purity (HPLC) | ≥ 95% |
| Peptide Content | ≥ 80% (by weight) |
| Amino Acid Sequence | DDPFLSIILTLTPNKNENNNFQILFQKCRFQHNSEIKIRSNMELNA |
| Molecular Weight | 4428.1 ± 2.0 Da |
| Water Content (KF) | ≤ 5.0% |
| Endotoxin Level | < 10 EU/mg |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


L-Arginine, L-asparaginyl-L-α-glutamyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-valyl-L-prolyl-L-α-aspartyl-L-threonyl-L-lysyl-L-valyl-L-asparaginyl-L-phenylalanyl-L-tyrosyl-L-alanyl-L-tryptophyl-L-lysyl- CAS NO 915091-83-7


Acetyl Octapeptide-1 CAS NO 868844-74-0


N2-(1-Oxohexadecyl)-L-Lysyl-L-Valyl-(2S)-2,4-Diaminobutanoyl-L-Threonine Bis(Trifluoroacetate) (Salt) CAS NO 883558-32-5


Copper Tripeptide CAS NO 89030-95-5


(D-Ala2)-Leu-Enkephalin CAS NO 64963-01-5


Copper Peptide CAS NO 49557-75-7


Orexin A (17-33) CAS NO 343268-91-7


H-Lys-Cys-Asp-Ile-Cys-Thr-Asp-Glu-Tyr-Oh CAS NO 197171-78-1


H-Pro-Leu-Gly-Nh2 CAS NO 2002-44-0


Pinealon CAS NO 175175-23-2


L-Arginine, Glycyl-L-Valyl-L-Seryl-L-Tryptophylglycyl-L-Leucyl- CAS NO 1801959-12-5


Melanotan Ii CAS NO 121062-08-6


Goralatide CAS NO 127103-11-1


H-β-Ala-β-Ala-Oh CAS NO 2140-53-6


α-Msh (11-13) (Free Acid) CAS NO 67727-97-3


Nesiritide Acetate CAS NO 114471-18-0


Tachyplesin CAS NO 118231-04-2


Exendin-4 CAS NO 141758-74-9


L-Serine, N2-(1-Oxotetradecyl)-L-Lysyl-L-Threonyl-L-Threonyl-L-Lysyl- CAS NO 1392416-25-9


Bremelanotide Acetate CAS NO 1607799-13-2
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






