Description

Urocortin (Human) is a synthetic 40-amino acid peptide belonging to the corticotropin-releasing factor (CRF) family, with the CAS registry number 176591-49-4. This biologically active neuropeptide is a critical research tool for studying stress response, cardiovascular function, and energy homeostasis pathways. It is essential for pharmaceutical R&D, academic research, and diagnostic development in the fields of neuroscience, endocrinology, and cardiology.

Application

• Neuroscience Research: Used as a standard or reagent in studies investigating the central nervous system's response to stress, anxiety, and depression.
• Cardiovascular Research: Employed in preclinical models to study its vasodilatory and cardioprotective effects, including potential therapeutic applications for heart failure.
• Endocrinology Studies: Serves as a key ligand for CRF receptor binding assays and signal transduction research related to the hypothalamic-pituitary-adrenal (HPA) axis.
• Pharmaceutical Development: Acts as a reference standard in the discovery and validation of novel therapeutics targeting CRF receptors for metabolic and psychiatric disorders.
• Diagnostic Kit Manufacturing: Utilized as a calibrated antigen or standard in the production of immunoassay kits for research and clinical testing.
• Cell Biology & Signal Transduction: Applied in in vitro cell culture studies to examine cellular responses and receptor activation mechanisms.

Basic Information

Product Name	Urocortin (Human)
CAS No.	176591-49-4
Molecular Formula	C198H310N56O58S
Molecular Weight	4428.1 g/mol
Synonyms	Human Urocortin; Urocortin I (Human); UCN; UCN1; Urocortin-1; hUCN; Stresscopin; Corticotropin-Releasing Factor 2 (CRF2) Ligand; 40AA Peptide (hUCN); DDPFLSIILTLTPNKNENNNFQILFQKCRFQHNSEIKIRSNMELNA
EINECS	Contact for details

Quality Control

Our Urocortin (Human) is manufactured under strict quality systems. Each batch undergoes comprehensive analytical testing, including HPLC for purity and identity verification, mass spectrometry for molecular weight confirmation, and rigorous testing for endotoxins and residual solvents. A comprehensive Certificate of Analysis (COA) detailing purity, peptide content, and analytical data is provided with every shipment to ensure traceability and compliance with research-grade standards.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store lyophilized powder at -20°C or below. Once reconstituted, aliquot and store solutions at -70°C to -80°C to prevent degradation. Avoid repeated freeze-thaw cycles. This product is hygroscopic (moisture-sensitive).

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC/MS)	Conforms to reference standard
Purity (HPLC)	≥ 95%
Peptide Content	≥ 80% (by weight)
Amino Acid Sequence	DDPFLSIILTLTPNKNENNNFQILFQKCRFQHNSEIKIRSNMELNA
Molecular Weight	4428.1 ± 2.0 Da
Water Content (KF)	≤ 5.0%
Endotoxin Level	< 10 EU/mg

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.