share

(Gly22)-Amyloid β-Protein (1-40) CAS NO 175010-18-1


Unit Price:

CAS No.:175010-18-1

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

(Gly22)-Amyloid β-Protein (1-40) is a synthetic peptide analog of the amyloid beta protein, a key molecule in Alzheimer's disease research. This modified peptide, featuring a glycine substitution at position 22, is critical for studying the structural determinants of amyloid aggregation and neurotoxicity. It is an essential research-grade biochemical for neuroscientists, pharmaceutical developers, and academic institutions focused on neurodegenerative disease mechanisms and therapeutic discovery.

Application

  • Biochemical Research: Fundamental studies on the aggregation kinetics, structural properties, and toxicity mechanisms of amyloid-beta peptides.
  • Drug Discovery & Screening: Used as a target substrate in high-throughput assays to identify and validate potential inhibitors of amyloid fibril formation.
  • Antibody & Diagnostic Development: Serves as a key antigen for generating and characterizing antibodies specific to amyloid-beta variants, aiding in diagnostic tool development.
  • Neuroscience Models: Application in cellular and animal models to investigate the pathophysiology of Alzheimer's disease and related dementias.
  • Structure-Activity Relationship (SAR) Studies: The Gly22 substitution allows researchers to probe the role of specific amino acid residues in peptide misfolding and oligomerization.
  • Reference Standard: Acts as a purified standard in analytical methods such as HPLC and mass spectrometry for quality control of related peptides.

Basic Information

Product Name (Gly22)-Amyloid β-Protein (1-40)
CAS No. 175010-18-1
Molecular Formula C194H295N55O58S
Molecular Weight 4329.8 g/mol
Synonyms Amyloid β-Protein (1-40) (Gly22); Aβ(1-40) (G22); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV; Amyloid β-Peptide (1-40) (Gly22); β-Amyloid (1-40), Gly22 variant; Aβ40 G22; Synthetic Amyloid-β Peptide Fragment
EINECS Contact for details

Quality Control

Our (Gly22)-Amyloid β-Protein (1-40) is manufactured under stringent conditions to ensure high purity and batch-to-batch consistency, suitable for sensitive research applications. Each lot is accompanied by a comprehensive Certificate of Analysis (COA) detailing purity, identity, and peptide content. Quality is verified through multiple orthogonal analytical techniques, including reverse-phase HPLC and mass spectrometry, to meet the exacting standards required for biomedical research.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This peptide is hygroscopic (moisture-sensitive) and easily oxidized; it is recommended to store under an inert atmosphere after opening and to aliquot to minimize freeze-thaw cycles. Allow the vial to equilibrate to room temperature before opening to prevent condensation.

Specification

Item Specification
Appearance White to off-white lyophilized powder
Identification (HPLC) Retention time corresponds to reference standard
Identification (MS) Molecular weight confirmed by mass spectrometry
Purity (HPLC) ≥ 95%
Peptide Content ≥ 70% (by weight)
Amino Acid Analysis Composition agrees with theoretical values
Solubility Soluble in water or dilute aqueous acetic acid

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.