Description

(Gly22)-Amyloid β-Protein (1-40) is a synthetic peptide analog of the amyloid beta protein, a key molecule in Alzheimer's disease research. This modified peptide, featuring a glycine substitution at position 22, is critical for studying the structural determinants of amyloid aggregation and neurotoxicity. It is an essential research-grade biochemical for neuroscientists, pharmaceutical developers, and academic institutions focused on neurodegenerative disease mechanisms and therapeutic discovery.

Application

• Biochemical Research: Fundamental studies on the aggregation kinetics, structural properties, and toxicity mechanisms of amyloid-beta peptides.
• Drug Discovery & Screening: Used as a target substrate in high-throughput assays to identify and validate potential inhibitors of amyloid fibril formation.
• Antibody & Diagnostic Development: Serves as a key antigen for generating and characterizing antibodies specific to amyloid-beta variants, aiding in diagnostic tool development.
• Neuroscience Models: Application in cellular and animal models to investigate the pathophysiology of Alzheimer's disease and related dementias.
• Structure-Activity Relationship (SAR) Studies: The Gly22 substitution allows researchers to probe the role of specific amino acid residues in peptide misfolding and oligomerization.
• Reference Standard: Acts as a purified standard in analytical methods such as HPLC and mass spectrometry for quality control of related peptides.

Basic Information

Product Name	(Gly22)-Amyloid β-Protein (1-40)
CAS No.	175010-18-1
Molecular Formula	C194H295N55O58S
Molecular Weight	4329.8 g/mol
Synonyms	Amyloid β-Protein (1-40) (Gly22); Aβ(1-40) (G22); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV; Amyloid β-Peptide (1-40) (Gly22); β-Amyloid (1-40), Gly22 variant; Aβ40 G22; Synthetic Amyloid-β Peptide Fragment
EINECS	Contact for details

Quality Control

Our (Gly22)-Amyloid β-Protein (1-40) is manufactured under stringent conditions to ensure high purity and batch-to-batch consistency, suitable for sensitive research applications. Each lot is accompanied by a comprehensive Certificate of Analysis (COA) detailing purity, identity, and peptide content. Quality is verified through multiple orthogonal analytical techniques, including reverse-phase HPLC and mass spectrometry, to meet the exacting standards required for biomedical research.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This peptide is hygroscopic (moisture-sensitive) and easily oxidized; it is recommended to store under an inert atmosphere after opening and to aliquot to minimize freeze-thaw cycles. Allow the vial to equilibrate to room temperature before opening to prevent condensation.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC)	Retention time corresponds to reference standard
Identification (MS)	Molecular weight confirmed by mass spectrometry
Purity (HPLC)	≥ 95%
Peptide Content	≥ 70% (by weight)
Amino Acid Analysis	Composition agrees with theoretical values
Solubility	Soluble in water or dilute aqueous acetic acid

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.