

share
Ecdysis-Triggering Hormone (Manduca Sexta) CAS NO 172519-53-8
Unit Price:
CAS No.:172519-53-8
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
Ecdysis-Triggering Hormone (Manduca Sexta) is a crucial insect neuropeptide that regulates the complex physiological process of molting (ecdysis) in the tobacco hornworm, *Manduca sexta*. This compound is essential for researchers in the fields of entomology, developmental biology, and insect endocrinology, serving as a key tool for understanding hormonal control of growth and metamorphosis. It is primarily used by academic, government, and industrial R&D laboratories focused on insect physiology, neurobiology, and the development of novel insect growth regulators for pest management strategies.
Application
- Fundamental Entomological Research: Studying the hormonal cascade and neural circuitry controlling ecdysis behavior in Lepidoptera.
- Insect Developmental Biology: Investigating the role of neuropeptides in molting, metamorphosis, and developmental timing.
- Insect Neuroendocrinology: Research into peptide hormone signaling, receptor interactions, and neurosecretory pathways.
- Mode-of-Action Studies for Pest Control: Target identification and validation for the development of next-generation, species-specific insect growth regulators (IGRs).
- Biochemical Assay Development: Use as a standard or ligand in receptor binding assays and activity tests.
- Comparative Physiology: Research on the evolution of neuropeptide systems across different insect orders.
Basic Information
| Product Name | Ecdysis-Triggering Hormone (Manduca Sexta) |
| CAS No. | 172519-53-8 |
| Molecular Formula | C73H115N21O22S2 |
| Molecular Weight | 1686.96 g/mol |
| Synonyms | Manduca sexta Ecdysis-Triggering Hormone; Mas-ETH; ETH; Insect Ecdysis-Triggering Hormone; ETH1; PEDLSGTMGFAARLGFGFAKNVKNVPRL-NH2 (Disulfide bridge: Cys1-Cys16); Neuropeptide ETH |
| EINECS | Contact for details |
Quality Control
Our Ecdysis-Triggering Hormone (Manduca Sexta) is produced and handled under strict quality protocols to ensure batch-to-batch consistency and biological activity. Each lot is characterized using advanced analytical techniques, including HPLC for purity verification and mass spectrometry for identity confirmation. A comprehensive Certificate of Analysis (COA) detailing purity, peptide content, and analytical data is provided with every shipment to support your research integrity.
Storage
Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC & MS) | Conforms to reference standard |
| Purity (HPLC) | ≥ 95% |
| Peptide Content | ≥ 80% (by weight) |
| Amino Acid Analysis | Conforms to theoretical composition |
| Solubility | Soluble in water, aqueous buffers, or DMSO |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


L-Arginine, L-asparaginyl-L-α-glutamyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-valyl-L-prolyl-L-α-aspartyl-L-threonyl-L-lysyl-L-valyl-L-asparaginyl-L-phenylalanyl-L-tyrosyl-L-alanyl-L-tryptophyl-L-lysyl- CAS NO 915091-83-7


Acetyl Octapeptide-1 CAS NO 868844-74-0


N2-(1-Oxohexadecyl)-L-Lysyl-L-Valyl-(2S)-2,4-Diaminobutanoyl-L-Threonine Bis(Trifluoroacetate) (Salt) CAS NO 883558-32-5


Copper Tripeptide CAS NO 89030-95-5


(D-Ala2)-Leu-Enkephalin CAS NO 64963-01-5


Copper Peptide CAS NO 49557-75-7


Orexin A (17-33) CAS NO 343268-91-7


H-Lys-Cys-Asp-Ile-Cys-Thr-Asp-Glu-Tyr-Oh CAS NO 197171-78-1


H-Pro-Leu-Gly-Nh2 CAS NO 2002-44-0


Pinealon CAS NO 175175-23-2


L-Arginine, Glycyl-L-Valyl-L-Seryl-L-Tryptophylglycyl-L-Leucyl- CAS NO 1801959-12-5


Melanotan Ii CAS NO 121062-08-6


Goralatide CAS NO 127103-11-1


H-β-Ala-β-Ala-Oh CAS NO 2140-53-6


α-Msh (11-13) (Free Acid) CAS NO 67727-97-3


Nesiritide Acetate CAS NO 114471-18-0


Tachyplesin CAS NO 118231-04-2


Exendin-4 CAS NO 141758-74-9


L-Serine, N2-(1-Oxotetradecyl)-L-Lysyl-L-Threonyl-L-Threonyl-L-Lysyl- CAS NO 1392416-25-9


Bremelanotide Acetate CAS NO 1607799-13-2
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






