Description

Ecdysis-Triggering Hormone (Manduca Sexta) is a crucial insect neuropeptide that regulates the complex physiological process of molting (ecdysis) in the tobacco hornworm, *Manduca sexta*. This compound is essential for researchers in the fields of entomology, developmental biology, and insect endocrinology, serving as a key tool for understanding hormonal control of growth and metamorphosis. It is primarily used by academic, government, and industrial R&D laboratories focused on insect physiology, neurobiology, and the development of novel insect growth regulators for pest management strategies.

Application

• Fundamental Entomological Research: Studying the hormonal cascade and neural circuitry controlling ecdysis behavior in Lepidoptera.
• Insect Developmental Biology: Investigating the role of neuropeptides in molting, metamorphosis, and developmental timing.
• Insect Neuroendocrinology: Research into peptide hormone signaling, receptor interactions, and neurosecretory pathways.
• Mode-of-Action Studies for Pest Control: Target identification and validation for the development of next-generation, species-specific insect growth regulators (IGRs).
• Biochemical Assay Development: Use as a standard or ligand in receptor binding assays and activity tests.
• Comparative Physiology: Research on the evolution of neuropeptide systems across different insect orders.

Basic Information

Product Name	Ecdysis-Triggering Hormone (Manduca Sexta)
CAS No.	172519-53-8
Molecular Formula	C73H115N21O22S2
Molecular Weight	1686.96 g/mol
Synonyms	Manduca sexta Ecdysis-Triggering Hormone; Mas-ETH; ETH; Insect Ecdysis-Triggering Hormone; ETH1; PEDLSGTMGFAARLGFGFAKNVKNVPRL-NH2 (Disulfide bridge: Cys1-Cys16); Neuropeptide ETH
EINECS	Contact for details

Quality Control

Our Ecdysis-Triggering Hormone (Manduca Sexta) is produced and handled under strict quality protocols to ensure batch-to-batch consistency and biological activity. Each lot is characterized using advanced analytical techniques, including HPLC for purity verification and mass spectrometry for identity confirmation. A comprehensive Certificate of Analysis (COA) detailing purity, peptide content, and analytical data is provided with every shipment to support your research integrity.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC & MS)	Conforms to reference standard
Purity (HPLC)	≥ 95%
Peptide Content	≥ 80% (by weight)
Amino Acid Analysis	Conforms to theoretical composition
Solubility	Soluble in water, aqueous buffers, or DMSO

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.