share

Adrenomedullin (22-52) (Human) CAS NO 159899-65-7


Unit Price:

CAS No.:159899-65-7

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

Adrenomedullin (22-52) (Human) is a bioactive peptide fragment derived from the full-length adrenomedullin hormone. This specific sequence is a critical research tool for investigating the physiological roles and receptor binding mechanisms of adrenomedullin in cardiovascular and renal systems. It is primarily utilized by pharmaceutical researchers, academic institutions, and biotechnology companies engaged in peptide-based drug discovery and metabolic pathway studies. The compound is supplied to meet the stringent purity requirements of advanced biomedical research.

Application

  • Biomedical Research: Used as a reference standard and active agent in studies exploring adrenomedullin's vasodilatory, cardioprotective, and diuretic effects.
  • Receptor Binding Assays: Serves as a key ligand for characterizing and antagonizing adrenomedullin receptors (AM1 and AM2) in competitive binding experiments.
  • Signal Pathway Analysis: Employed to dissect intracellular signaling cascades, such as cAMP and nitric oxide pathways, activated by adrenomedullin.
  • Pharmaceutical Development: Acts as a precursor or model compound for designing novel peptide therapeutics targeting hypertension, heart failure, and sepsis.
  • In Vitro Diagnostics: Utilized in the development and calibration of immunoassays (e.g., ELISA) for detecting adrenomedullin levels in biological samples.

Basic Information

Product Name Adrenomedullin (22-52) (Human)
CAS No. 159899-65-7
Molecular Formula C144H231N43O41S
Molecular Weight 3168.7 g/mol
Synonyms ADM (22-52), Human; Adrenomedullin Fragment 22-52; hADM(22-52); TYR-RMSMKLFRVDKFEKQTKTAKLKIQYAVSKRRSGG-NH2 (Disulfide bridge: Cys16-Cys21); H-Tyr-Arg-Met-Ser-Met-Lys-Leu-Phe-Arg-Val-Asp-Lys-Phe-Glu-Lys-Gln-Thr-Lys-Thr-Ala-Lys-Leu-Lys-Ile-Gln-Tyr-Ala-Val-Ser-Lys-Arg-Arg-Ser-Gly-Gly-NH2
EINECS Contact for details

Quality Control

Our Adrenomedullin (22-52) (Human) is manufactured under controlled conditions to ensure high batch-to-batch consistency suitable for research applications. Each lot undergoes rigorous analytical testing, including HPLC for purity assessment and mass spectrometry for identity confirmation. Certificates of Analysis (COA) detailing purity, peptide content, and solvent residues are available upon request.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to reach room temperature in a desiccator before opening to minimize moisture absorption. For long-term storage, keep desiccated at -20°C.

Specification

Item Specification
Appearance White to off-white lyophilized powder
Identification (HPLC/MS) Conforms to reference standard
Purity (HPLC) ≥ 95%
Peptide Content ≥ 80%
Single Impurity (HPLC) ≤ 1.0%
Amino Acid Analysis ± 10% of theoretical
Water Content (KF) ≤ 5.0%
Acetate Content (HPLC) ≤ 10.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.