

share
Adrenomedullin (22-52) (Human) CAS NO 159899-65-7
Unit Price:
CAS No.:159899-65-7
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
Adrenomedullin (22-52) (Human) is a bioactive peptide fragment derived from the full-length adrenomedullin hormone. This specific sequence is a critical research tool for investigating the physiological roles and receptor binding mechanisms of adrenomedullin in cardiovascular and renal systems. It is primarily utilized by pharmaceutical researchers, academic institutions, and biotechnology companies engaged in peptide-based drug discovery and metabolic pathway studies. The compound is supplied to meet the stringent purity requirements of advanced biomedical research.
Application
- Biomedical Research: Used as a reference standard and active agent in studies exploring adrenomedullin's vasodilatory, cardioprotective, and diuretic effects.
- Receptor Binding Assays: Serves as a key ligand for characterizing and antagonizing adrenomedullin receptors (AM1 and AM2) in competitive binding experiments.
- Signal Pathway Analysis: Employed to dissect intracellular signaling cascades, such as cAMP and nitric oxide pathways, activated by adrenomedullin.
- Pharmaceutical Development: Acts as a precursor or model compound for designing novel peptide therapeutics targeting hypertension, heart failure, and sepsis.
- In Vitro Diagnostics: Utilized in the development and calibration of immunoassays (e.g., ELISA) for detecting adrenomedullin levels in biological samples.
Basic Information
| Product Name | Adrenomedullin (22-52) (Human) |
| CAS No. | 159899-65-7 |
| Molecular Formula | C144H231N43O41S |
| Molecular Weight | 3168.7 g/mol |
| Synonyms | ADM (22-52), Human; Adrenomedullin Fragment 22-52; hADM(22-52); TYR-RMSMKLFRVDKFEKQTKTAKLKIQYAVSKRRSGG-NH2 (Disulfide bridge: Cys16-Cys21); H-Tyr-Arg-Met-Ser-Met-Lys-Leu-Phe-Arg-Val-Asp-Lys-Phe-Glu-Lys-Gln-Thr-Lys-Thr-Ala-Lys-Leu-Lys-Ile-Gln-Tyr-Ala-Val-Ser-Lys-Arg-Arg-Ser-Gly-Gly-NH2 |
| EINECS | Contact for details |
Quality Control
Our Adrenomedullin (22-52) (Human) is manufactured under controlled conditions to ensure high batch-to-batch consistency suitable for research applications. Each lot undergoes rigorous analytical testing, including HPLC for purity assessment and mass spectrometry for identity confirmation. Certificates of Analysis (COA) detailing purity, peptide content, and solvent residues are available upon request.
Storage
Preserve in a tightly closed container, protected from light. Store at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to reach room temperature in a desiccator before opening to minimize moisture absorption. For long-term storage, keep desiccated at -20°C.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC/MS) | Conforms to reference standard |
| Purity (HPLC) | ≥ 95% |
| Peptide Content | ≥ 80% |
| Single Impurity (HPLC) | ≤ 1.0% |
| Amino Acid Analysis | ± 10% of theoretical |
| Water Content (KF) | ≤ 5.0% |
| Acetate Content (HPLC) | ≤ 10.0% |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


L-Arginine, L-asparaginyl-L-α-glutamyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-valyl-L-prolyl-L-α-aspartyl-L-threonyl-L-lysyl-L-valyl-L-asparaginyl-L-phenylalanyl-L-tyrosyl-L-alanyl-L-tryptophyl-L-lysyl- CAS NO 915091-83-7


Acetyl Octapeptide-1 CAS NO 868844-74-0


N2-(1-Oxohexadecyl)-L-Lysyl-L-Valyl-(2S)-2,4-Diaminobutanoyl-L-Threonine Bis(Trifluoroacetate) (Salt) CAS NO 883558-32-5


Copper Tripeptide CAS NO 89030-95-5


(D-Ala2)-Leu-Enkephalin CAS NO 64963-01-5


Copper Peptide CAS NO 49557-75-7


Orexin A (17-33) CAS NO 343268-91-7


H-Lys-Cys-Asp-Ile-Cys-Thr-Asp-Glu-Tyr-Oh CAS NO 197171-78-1


H-Pro-Leu-Gly-Nh2 CAS NO 2002-44-0


Pinealon CAS NO 175175-23-2


L-Arginine, Glycyl-L-Valyl-L-Seryl-L-Tryptophylglycyl-L-Leucyl- CAS NO 1801959-12-5


Melanotan Ii CAS NO 121062-08-6


Goralatide CAS NO 127103-11-1


H-β-Ala-β-Ala-Oh CAS NO 2140-53-6


α-Msh (11-13) (Free Acid) CAS NO 67727-97-3


Nesiritide Acetate CAS NO 114471-18-0


Tachyplesin CAS NO 118231-04-2


Exendin-4 CAS NO 141758-74-9


L-Serine, N2-(1-Oxotetradecyl)-L-Lysyl-L-Threonyl-L-Threonyl-L-Lysyl- CAS NO 1392416-25-9


Bremelanotide Acetate CAS NO 1607799-13-2
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






