share

Amyloid β-Protein (3-40) CAS NO 157884-70-3


Unit Price:

CAS No.:157884-70-3

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

Amyloid β-Protein (3-40) is a specific, truncated peptide fragment derived from the larger amyloid precursor protein (APP). This compound is of significant scientific interest as a key intermediate and biomarker in the study of amyloid beta peptide aggregation and neurotoxicity. It is primarily utilized by research institutions and pharmaceutical companies engaged in neuroscience, Alzheimer's disease research, and therapeutic development.

Application

  • Neuroscience Research: Used as a critical reagent for studying the aggregation kinetics, structural properties, and toxicity of amyloid beta peptides in vitro.
  • Alzheimer's Disease Studies: Serves as a standard or reference material in assays designed to model the pathological formation of amyloid plaques.
  • Drug Discovery & Screening: Employed in high-throughput screening (HTS) platforms to identify and validate potential inhibitors of amyloid beta aggregation.
  • Biomarker Development: Acts as a calibrant or control in the development of immunoassays (ELISA, Western Blot) for detecting specific amyloid beta fragments in biological samples.
  • Biophysical Characterization: Utilized in techniques such as NMR, CD spectroscopy, and electron microscopy to elucidate the secondary structure and oligomerization states of amyloid peptides.
  • Antibody Production & Validation: Used as an antigen for generating and testing the specificity of antibodies targeting the N-terminal region of amyloid beta.

Basic Information

Product Name Amyloid β-Protein (3-40)
CAS No. 157884-70-3
Molecular Formula C185H281N51O57S
Molecular Weight 4131.6 g/mol
Synonyms Amyloid β-Protein (3-40); Aβ (3-40); β-Amyloid Peptide (3-40); Amyloid β-Peptide (3-40); Aβ3-40; Amyloid Beta (3-40) Fragment; APP (672-709); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
EINECS Contact for details

Quality Control

Our Amyloid β-Protein (3-40) is produced under stringent conditions to ensure high purity and batch-to-batch consistency, suitable for sensitive research applications. Each lot is accompanied by a comprehensive Certificate of Analysis (COA) detailing purity, identity, and peptide content. Quality is verified through multiple analytical techniques including HPLC, Mass Spectrometry (MS), and Amino Acid Analysis (AAA).

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake.

Specification

Item Specification
Appearance White to off-white lyophilized powder
Identification (HPLC & MS) Conforms to standard
Purity (HPLC) ≥ 95%
Peptide Content ≥ 80% (by AAA)
Molecular Weight 4131.6 ± 2.0 Da (by MS)
Solubility Soluble in dilute acetic acid or DMSO
Endotoxin Level < 1.0 EU/mg

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.