

share
Amyloid β-Protein (3-40) CAS NO 157884-70-3
Unit Price:
CAS No.:157884-70-3
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
Amyloid β-Protein (3-40) is a specific, truncated peptide fragment derived from the larger amyloid precursor protein (APP). This compound is of significant scientific interest as a key intermediate and biomarker in the study of amyloid beta peptide aggregation and neurotoxicity. It is primarily utilized by research institutions and pharmaceutical companies engaged in neuroscience, Alzheimer's disease research, and therapeutic development.
Application
- Neuroscience Research: Used as a critical reagent for studying the aggregation kinetics, structural properties, and toxicity of amyloid beta peptides in vitro.
- Alzheimer's Disease Studies: Serves as a standard or reference material in assays designed to model the pathological formation of amyloid plaques.
- Drug Discovery & Screening: Employed in high-throughput screening (HTS) platforms to identify and validate potential inhibitors of amyloid beta aggregation.
- Biomarker Development: Acts as a calibrant or control in the development of immunoassays (ELISA, Western Blot) for detecting specific amyloid beta fragments in biological samples.
- Biophysical Characterization: Utilized in techniques such as NMR, CD spectroscopy, and electron microscopy to elucidate the secondary structure and oligomerization states of amyloid peptides.
- Antibody Production & Validation: Used as an antigen for generating and testing the specificity of antibodies targeting the N-terminal region of amyloid beta.
Basic Information
| Product Name | Amyloid β-Protein (3-40) |
| CAS No. | 157884-70-3 |
| Molecular Formula | C185H281N51O57S |
| Molecular Weight | 4131.6 g/mol |
| Synonyms | Amyloid β-Protein (3-40); Aβ (3-40); β-Amyloid Peptide (3-40); Amyloid β-Peptide (3-40); Aβ3-40; Amyloid Beta (3-40) Fragment; APP (672-709); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| EINECS | Contact for details |
Quality Control
Our Amyloid β-Protein (3-40) is produced under stringent conditions to ensure high purity and batch-to-batch consistency, suitable for sensitive research applications. Each lot is accompanied by a comprehensive Certificate of Analysis (COA) detailing purity, identity, and peptide content. Quality is verified through multiple analytical techniques including HPLC, Mass Spectrometry (MS), and Amino Acid Analysis (AAA).
Storage
Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC & MS) | Conforms to standard |
| Purity (HPLC) | ≥ 95% |
| Peptide Content | ≥ 80% (by AAA) |
| Molecular Weight | 4131.6 ± 2.0 Da (by MS) |
| Solubility | Soluble in dilute acetic acid or DMSO |
| Endotoxin Level | < 1.0 EU/mg |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


L-Arginine, L-asparaginyl-L-α-glutamyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-valyl-L-prolyl-L-α-aspartyl-L-threonyl-L-lysyl-L-valyl-L-asparaginyl-L-phenylalanyl-L-tyrosyl-L-alanyl-L-tryptophyl-L-lysyl- CAS NO 915091-83-7


Acetyl Octapeptide-1 CAS NO 868844-74-0


N2-(1-Oxohexadecyl)-L-Lysyl-L-Valyl-(2S)-2,4-Diaminobutanoyl-L-Threonine Bis(Trifluoroacetate) (Salt) CAS NO 883558-32-5


Copper Tripeptide CAS NO 89030-95-5


(D-Ala2)-Leu-Enkephalin CAS NO 64963-01-5


Copper Peptide CAS NO 49557-75-7


Orexin A (17-33) CAS NO 343268-91-7


H-Lys-Cys-Asp-Ile-Cys-Thr-Asp-Glu-Tyr-Oh CAS NO 197171-78-1


H-Pro-Leu-Gly-Nh2 CAS NO 2002-44-0


Pinealon CAS NO 175175-23-2


L-Arginine, Glycyl-L-Valyl-L-Seryl-L-Tryptophylglycyl-L-Leucyl- CAS NO 1801959-12-5


Melanotan Ii CAS NO 121062-08-6


Goralatide CAS NO 127103-11-1


H-β-Ala-β-Ala-Oh CAS NO 2140-53-6


α-Msh (11-13) (Free Acid) CAS NO 67727-97-3


Nesiritide Acetate CAS NO 114471-18-0


Tachyplesin CAS NO 118231-04-2


Exendin-4 CAS NO 141758-74-9


L-Serine, N2-(1-Oxotetradecyl)-L-Lysyl-L-Threonyl-L-Threonyl-L-Lysyl- CAS NO 1392416-25-9


Bremelanotide Acetate CAS NO 1607799-13-2
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






