

share
Adrenomedullin (13-52) (Human) CAS NO 154765-05-6
Unit Price:
CAS No.:154765-05-6
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
Adrenomedullin (13-52) (Human) is a specific bioactive fragment of the human adrenomedullin peptide, a potent vasodilator and regulator of cardiovascular and renal function. This high-purity peptide is critical for advanced biochemical research and pharmaceutical development, enabling precise study of receptor interactions and signaling pathways. It is primarily utilized by research institutions, diagnostic manufacturers, and biopharmaceutical companies focused on cardiovascular disease, sepsis, and hypertension.
Application
- Biomedical Research: Used as a reference standard and active agent in studies investigating adrenomedullin's role in cardiovascular physiology, inflammation, and tumor biology.
- Receptor Binding Assays: Essential for competitive binding studies to characterize and quantify adrenomedullin receptors (e.g., CLR/RAMP2, CLR/RAMP3 complexes).
- Diagnostic Kit Development: Serves as a key antigen or calibrator in the development of immunoassays (ELISA, RIA) for measuring adrenomedullin levels in clinical samples.
- Pharmacological Studies: Employed in vitro and in vivo to study the antagonistic effects of the (13-52) fragment on full-length adrenomedullin activity.
- Signal Transduction Research: A vital tool for elucidating downstream cAMP and other second messenger pathways activated by adrenomedullin receptor engagement.
- Quality Control: Acts as a purity and identity standard for the quality assurance of related peptide pharmaceuticals and research reagents.
Basic Information
| Product Name | Adrenomedullin (13-52) (Human) |
| CAS No. | 154765-05-6 |
| Molecular Formula | C185H306N56O53S2 |
| Molecular Weight | 4251.9 g/mol |
| Synonyms | ADM (13-52), Human; Adrenomedullin Fragment 13-52; hADM(13-52); Preproadrenomedullin (153-185) (human); TYR-RKRSMSPLMQGYRQGSPFQKTGVQRSKSPKLQ; AM (13-52); Adrenomedullin, human (13-52) |
| EINECS | Contact for details |
Quality Control
Our Adrenomedullin (13-52) (Human) is manufactured under strict quality systems. Each batch undergoes rigorous analytical testing, including HPLC for purity and MS for identity confirmation, to ensure it meets the high standards required for research and development. A comprehensive Certificate of Analysis (COA) detailing purity, peptide content, and analytical data is provided with every shipment.
Storage
Preserve in a tightly closed container, protected from light. Store desiccated at -20°C or below for long-term stability. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a dry environment before opening to minimize moisture uptake.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC) | Retention time corresponds to reference standard |
| Identification (MS) | Molecular weight confirmed by mass spectrometry |
| Purity (HPLC) | ≥ 95% |
| Peptide Content | ≥ 80% (by weight) |
| Water Content (KF) | ≤ 5.0% |
| Acetate Content (HPLC) | ≤ 10.0% |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


L-Arginine, L-asparaginyl-L-α-glutamyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-valyl-L-prolyl-L-α-aspartyl-L-threonyl-L-lysyl-L-valyl-L-asparaginyl-L-phenylalanyl-L-tyrosyl-L-alanyl-L-tryptophyl-L-lysyl- CAS NO 915091-83-7


Acetyl Octapeptide-1 CAS NO 868844-74-0


N2-(1-Oxohexadecyl)-L-Lysyl-L-Valyl-(2S)-2,4-Diaminobutanoyl-L-Threonine Bis(Trifluoroacetate) (Salt) CAS NO 883558-32-5


Copper Tripeptide CAS NO 89030-95-5


(D-Ala2)-Leu-Enkephalin CAS NO 64963-01-5


Copper Peptide CAS NO 49557-75-7


Orexin A (17-33) CAS NO 343268-91-7


H-Lys-Cys-Asp-Ile-Cys-Thr-Asp-Glu-Tyr-Oh CAS NO 197171-78-1


H-Pro-Leu-Gly-Nh2 CAS NO 2002-44-0


Pinealon CAS NO 175175-23-2


L-Arginine, Glycyl-L-Valyl-L-Seryl-L-Tryptophylglycyl-L-Leucyl- CAS NO 1801959-12-5


Melanotan Ii CAS NO 121062-08-6


Goralatide CAS NO 127103-11-1


H-β-Ala-β-Ala-Oh CAS NO 2140-53-6


α-Msh (11-13) (Free Acid) CAS NO 67727-97-3


Nesiritide Acetate CAS NO 114471-18-0


Tachyplesin CAS NO 118231-04-2


Exendin-4 CAS NO 141758-74-9


L-Serine, N2-(1-Oxotetradecyl)-L-Lysyl-L-Threonyl-L-Threonyl-L-Lysyl- CAS NO 1392416-25-9


Bremelanotide Acetate CAS NO 1607799-13-2
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






