share

Adrenomedullin (13-52) (Human) CAS NO 154765-05-6


Unit Price:

CAS No.:154765-05-6

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

Adrenomedullin (13-52) (Human) is a specific bioactive fragment of the human adrenomedullin peptide, a potent vasodilator and regulator of cardiovascular and renal function. This high-purity peptide is critical for advanced biochemical research and pharmaceutical development, enabling precise study of receptor interactions and signaling pathways. It is primarily utilized by research institutions, diagnostic manufacturers, and biopharmaceutical companies focused on cardiovascular disease, sepsis, and hypertension.

Application

  • Biomedical Research: Used as a reference standard and active agent in studies investigating adrenomedullin's role in cardiovascular physiology, inflammation, and tumor biology.
  • Receptor Binding Assays: Essential for competitive binding studies to characterize and quantify adrenomedullin receptors (e.g., CLR/RAMP2, CLR/RAMP3 complexes).
  • Diagnostic Kit Development: Serves as a key antigen or calibrator in the development of immunoassays (ELISA, RIA) for measuring adrenomedullin levels in clinical samples.
  • Pharmacological Studies: Employed in vitro and in vivo to study the antagonistic effects of the (13-52) fragment on full-length adrenomedullin activity.
  • Signal Transduction Research: A vital tool for elucidating downstream cAMP and other second messenger pathways activated by adrenomedullin receptor engagement.
  • Quality Control: Acts as a purity and identity standard for the quality assurance of related peptide pharmaceuticals and research reagents.

Basic Information

Product Name Adrenomedullin (13-52) (Human)
CAS No. 154765-05-6
Molecular Formula C185H306N56O53S2
Molecular Weight 4251.9 g/mol
Synonyms ADM (13-52), Human; Adrenomedullin Fragment 13-52; hADM(13-52); Preproadrenomedullin (153-185) (human); TYR-RKRSMSPLMQGYRQGSPFQKTGVQRSKSPKLQ; AM (13-52); Adrenomedullin, human (13-52)
EINECS Contact for details

Quality Control

Our Adrenomedullin (13-52) (Human) is manufactured under strict quality systems. Each batch undergoes rigorous analytical testing, including HPLC for purity and MS for identity confirmation, to ensure it meets the high standards required for research and development. A comprehensive Certificate of Analysis (COA) detailing purity, peptide content, and analytical data is provided with every shipment.

Storage

Preserve in a tightly closed container, protected from light. Store desiccated at -20°C or below for long-term stability. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a dry environment before opening to minimize moisture uptake.

Specification

Item Specification
Appearance White to off-white lyophilized powder
Identification (HPLC) Retention time corresponds to reference standard
Identification (MS) Molecular weight confirmed by mass spectrometry
Purity (HPLC) ≥ 95%
Peptide Content ≥ 80% (by weight)
Water Content (KF) ≤ 5.0%
Acetate Content (HPLC) ≤ 10.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.