

share
(Gly21)-Amyloid β-Protein (1-40) CAS NO 154362-03-5
Unit Price:
CAS No.:154362-03-5
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
(Gly21)-Amyloid β-Protein (1-40) CAS NO 154362-03-5 is a synthetic peptide analog of the amyloid beta protein, a key molecule in neurological research. This high-purity, sequence-specific peptide is critical for studying protein aggregation mechanisms and their role in neurodegenerative disease pathology. It is an essential research reagent for pharmaceutical R&D, academic institutions, and diagnostic developers focused on Alzheimer's disease and related conditions.
Application
- Biomedical Research: Fundamental studies on amyloid beta aggregation kinetics, fibril formation, and oligomer toxicity.
- Drug Discovery & Screening: Target compound for high-throughput screening (HTS) assays to identify potential inhibitors of amyloid aggregation.
- Antibody & Diagnostic Development: Key antigen for the production and validation of antibodies, ELISA kits, and other diagnostic tools for Alzheimer's disease biomarkers.
- Neurotoxicity Studies: Used in cell-based and animal model experiments to investigate the pathological effects of amyloid peptides on neuronal cells.
- Biophysical Characterization: Subject for analytical techniques like circular dichroism (CD), nuclear magnetic resonance (NMR), and mass spectrometry to study protein structure and stability.
- Reference Standard: Serves as a qualified reference material for quality control and method validation in related research and development.
Basic Information
| Item | Detail |
|---|---|
| Product Name | (Gly21)-Amyloid β-Protein (1-40) |
| CAS No. | 154362-03-5 |
| Molecular Formula | C194H295N55O58S |
| Molecular Weight | 4329.8 g/mol |
| Synonyms | Amyloid β-Protein (1-40) (G21G); Aβ(1-40) (G21G); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV; β-Amyloid (1-40), Gly21-substituted; Amyloid β-Peptide (1-40) (Human, G21G); Synthetic Aβ40 (G21G) variant |
| EINECS | Contact for details |
Quality Control
Every batch of (Gly21)-Amyloid β-Protein (1-40) is produced and analyzed under stringent conditions to ensure the highest standards of identity, purity, and consistency. Our quality assurance protocol includes comprehensive analytical characterization. Certificates of Analysis (COA) detailing purity (by HPLC), molecular weight confirmation (by MS), and peptide content are provided with each shipment to support your critical research and compliance needs.
Storage
Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and hydrolysis. Aliquot into single-use quantities to avoid repeated freeze-thaw cycles.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC & MS) | Retention time and mass correspond to reference |
| Purity (HPLC) | ≥ 95% (Area Percent) |
| Molecular Weight | 4329.8 ± 2.0 Da (MALDI-TOF or ESI-MS) |
| Peptide Content | ≥ 70% (by Amino Acid Analysis or UV spectrophotometry) |
| Solubility | Soluble in dilute ammonium hydroxide or DMSO; forms clear, colorless solution |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


L-Arginine, L-asparaginyl-L-α-glutamyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-valyl-L-prolyl-L-α-aspartyl-L-threonyl-L-lysyl-L-valyl-L-asparaginyl-L-phenylalanyl-L-tyrosyl-L-alanyl-L-tryptophyl-L-lysyl- CAS NO 915091-83-7


Acetyl Octapeptide-1 CAS NO 868844-74-0


N2-(1-Oxohexadecyl)-L-Lysyl-L-Valyl-(2S)-2,4-Diaminobutanoyl-L-Threonine Bis(Trifluoroacetate) (Salt) CAS NO 883558-32-5


Copper Tripeptide CAS NO 89030-95-5


(D-Ala2)-Leu-Enkephalin CAS NO 64963-01-5


Copper Peptide CAS NO 49557-75-7


Orexin A (17-33) CAS NO 343268-91-7


H-Lys-Cys-Asp-Ile-Cys-Thr-Asp-Glu-Tyr-Oh CAS NO 197171-78-1


H-Pro-Leu-Gly-Nh2 CAS NO 2002-44-0


Pinealon CAS NO 175175-23-2


L-Arginine, Glycyl-L-Valyl-L-Seryl-L-Tryptophylglycyl-L-Leucyl- CAS NO 1801959-12-5


Melanotan Ii CAS NO 121062-08-6


Goralatide CAS NO 127103-11-1


H-β-Ala-β-Ala-Oh CAS NO 2140-53-6


α-Msh (11-13) (Free Acid) CAS NO 67727-97-3


Nesiritide Acetate CAS NO 114471-18-0


Tachyplesin CAS NO 118231-04-2


Exendin-4 CAS NO 141758-74-9


L-Serine, N2-(1-Oxotetradecyl)-L-Lysyl-L-Threonyl-L-Threonyl-L-Lysyl- CAS NO 1392416-25-9


Bremelanotide Acetate CAS NO 1607799-13-2
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






