Description

(Gly21)-Amyloid β-Protein (1-40) CAS NO 154362-03-5 is a synthetic peptide analog of the amyloid beta protein, a key molecule in neurological research. This high-purity, sequence-specific peptide is critical for studying protein aggregation mechanisms and their role in neurodegenerative disease pathology. It is an essential research reagent for pharmaceutical R&D, academic institutions, and diagnostic developers focused on Alzheimer's disease and related conditions.

Application

• Biomedical Research: Fundamental studies on amyloid beta aggregation kinetics, fibril formation, and oligomer toxicity.
• Drug Discovery & Screening: Target compound for high-throughput screening (HTS) assays to identify potential inhibitors of amyloid aggregation.
• Antibody & Diagnostic Development: Key antigen for the production and validation of antibodies, ELISA kits, and other diagnostic tools for Alzheimer's disease biomarkers.
• Neurotoxicity Studies: Used in cell-based and animal model experiments to investigate the pathological effects of amyloid peptides on neuronal cells.
• Biophysical Characterization: Subject for analytical techniques like circular dichroism (CD), nuclear magnetic resonance (NMR), and mass spectrometry to study protein structure and stability.
• Reference Standard: Serves as a qualified reference material for quality control and method validation in related research and development.

Basic Information

Item	Detail
Product Name	(Gly21)-Amyloid β-Protein (1-40)
CAS No.	154362-03-5
Molecular Formula	C194H295N55O58S
Molecular Weight	4329.8 g/mol
Synonyms	Amyloid β-Protein (1-40) (G21G); Aβ(1-40) (G21G); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV; β-Amyloid (1-40), Gly21-substituted; Amyloid β-Peptide (1-40) (Human, G21G); Synthetic Aβ40 (G21G) variant
EINECS	Contact for details

Quality Control

Every batch of (Gly21)-Amyloid β-Protein (1-40) is produced and analyzed under stringent conditions to ensure the highest standards of identity, purity, and consistency. Our quality assurance protocol includes comprehensive analytical characterization. Certificates of Analysis (COA) detailing purity (by HPLC), molecular weight confirmation (by MS), and peptide content are provided with each shipment to support your critical research and compliance needs.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and hydrolysis. Aliquot into single-use quantities to avoid repeated freeze-thaw cycles.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC & MS)	Retention time and mass correspond to reference
Purity (HPLC)	≥ 95% (Area Percent)
Molecular Weight	4329.8 ± 2.0 Da (MALDI-TOF or ESI-MS)
Peptide Content	≥ 70% (by Amino Acid Analysis or UV spectrophotometry)
Solubility	Soluble in dilute ammonium hydroxide or DMSO; forms clear, colorless solution

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.