Description

H-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-Nh2 is a synthetic peptide with the CAS number 150138-78-6. This compound is of significant interest in advanced biomedical research and pharmaceutical development due to its specific amino acid sequence and biological activity. It is primarily required by research institutions and biotechnology companies engaged in peptide-based drug discovery, metabolic studies, and the development of novel therapeutic agents.

Application

• Biomedical Research: Used as a reference standard or active investigational compound in studies of peptide-receptor interactions, signal transduction pathways, and metabolic functions.
• Pharmaceutical Development: Serves as a key intermediate or active pharmaceutical ingredient (API) in the preclinical development of peptide-based therapeutics targeting specific biological processes.
• Diagnostic Reagent Manufacturing: Employed in the formulation of high-sensitivity assay kits and diagnostic tools for clinical research and biomarker detection.
• Bioconjugation & Probe Synthesis: Acts as a scaffold for creating labeled probes (e.g., fluorescent, radioactive) used in cellular imaging and molecular biology techniques.
• Enzyme & Protein Interaction Studies: Utilized to investigate substrate specificity, inhibition mechanisms, and the functional roles of specific peptide sequences in complex biological systems.

Basic Information

Product Name	H-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-Nh2
CAS No.	150138-78-6
Molecular Formula	C179H284N58O55S
Molecular Weight	~4125.6 g/mol
Synonyms	SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2; Peptide SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY amide; H-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2; CAS 150138-78-6; 34-amino acid peptide amide
EINECS	Contact for details

Quality Control

Our peptide products are manufactured under strict quality management systems to ensure batch-to-batch consistency and high purity. Each lot undergoes comprehensive analytical characterization, including HPLC for purity and MS for identity confirmation. Certificates of Analysis (COA) detailing all specifications and test results are provided and available upon request to support your regulatory and research documentation needs.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below in a dry environment. This product is hygroscopic (moisture-sensitive). For long-term storage, it is recommended to store desiccated under inert atmosphere. Allow the vial to warm to room temperature before opening to minimize moisture absorption.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC/MS)	Conforms to reference
Purity (HPLC)	≥ 95%
Peptide Content	≥ 80%
Single Impurity (HPLC)	≤ 1.0%
Water Content (KF)	≤ 5.0%
Acetate Content (HPLC/IC)	≤ 10.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.