

share
H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Oh CAS NO 136799-54-7
Unit Price:
CAS No.:136799-54-7
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Oh is a synthetic peptide sequence of significant interest in advanced biochemical research and development. This compound is valued for its precise structure, which enables its use as a critical tool in studying protein-protein interactions, enzyme mechanisms, and as a potential precursor for novel therapeutic agents. It is primarily required by biotechnology firms, pharmaceutical research laboratories, and academic institutions engaged in peptide chemistry, immunology, and drug discovery programs.
Application
- Biochemical Research: Serves as a high-purity reference standard or substrate in enzymatic studies and interaction assays.
- Pharmaceutical R&D: Used as a key intermediate or building block in the development of peptide-based therapeutics and diagnostic agents.
- Immunology Studies: Potential application as an antigen or epitope for antibody production and vaccine research.
- Proteomics & Signal Transduction: A tool for investigating specific signaling pathways and post-translational modifications.
- Academic Research: Employed in university laboratories for teaching and fundamental research in peptide synthesis and molecular biology.
- Custom Peptide Synthesis: Acts as a starting point or template for the custom synthesis of modified peptide analogs.
Basic Information
| Product Name | H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Oh |
| CAS No. | 136799-54-7 |
| Molecular Formula | C179H295N57O55S2 |
| Molecular Weight | ~4125.7 g/mol |
| Synonyms | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL-OH; 36-Amino acid peptide (SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL); H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leucinol; Peptide Sequence 136799-54-7; Synthetic Polypeptide; Custom Peptide 136799-54-7 |
| EINECS | Contact for details |
Quality Control
Our peptide products are manufactured and analyzed under strict quality management systems. Each batch of H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Oh undergoes rigorous analytical testing, including HPLC for purity, MS for identity confirmation, and amino acid analysis. Certificates of Analysis (COA) detailing all specifications are provided to ensure traceability and compliance with your research requirements.
Storage
Preserve in a tightly closed container, protected from light. Store at -20°C or below in a dry environment. This product is hygroscopic (moisture-sensitive). For long-term storage, keep desiccated. Allow the vial to equilibrate to room temperature before opening to minimize moisture absorption.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white powder |
| Identification (HPLC & MS) | Conforms to reference |
| Purity (HPLC) | ≥ 95% |
| Single Impurity (HPLC) | ≤ 1.0% |
| Amino Acid Composition | Within ±10% of theoretical |
| Peptide Content | ≥ 80% |
| Water Content (KF) | ≤ 5.0% |
| Acetate Content (HPIC) | ≤ 10.0% |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


L-Arginine, L-asparaginyl-L-α-glutamyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-valyl-L-prolyl-L-α-aspartyl-L-threonyl-L-lysyl-L-valyl-L-asparaginyl-L-phenylalanyl-L-tyrosyl-L-alanyl-L-tryptophyl-L-lysyl- CAS NO 915091-83-7


Acetyl Octapeptide-1 CAS NO 868844-74-0


N2-(1-Oxohexadecyl)-L-Lysyl-L-Valyl-(2S)-2,4-Diaminobutanoyl-L-Threonine Bis(Trifluoroacetate) (Salt) CAS NO 883558-32-5


Copper Tripeptide CAS NO 89030-95-5


(D-Ala2)-Leu-Enkephalin CAS NO 64963-01-5


Copper Peptide CAS NO 49557-75-7


Orexin A (17-33) CAS NO 343268-91-7


H-Lys-Cys-Asp-Ile-Cys-Thr-Asp-Glu-Tyr-Oh CAS NO 197171-78-1


H-Pro-Leu-Gly-Nh2 CAS NO 2002-44-0


Pinealon CAS NO 175175-23-2


L-Arginine, Glycyl-L-Valyl-L-Seryl-L-Tryptophylglycyl-L-Leucyl- CAS NO 1801959-12-5


Melanotan Ii CAS NO 121062-08-6


Goralatide CAS NO 127103-11-1


H-β-Ala-β-Ala-Oh CAS NO 2140-53-6


α-Msh (11-13) (Free Acid) CAS NO 67727-97-3


Nesiritide Acetate CAS NO 114471-18-0


Tachyplesin CAS NO 118231-04-2


Exendin-4 CAS NO 141758-74-9


L-Serine, N2-(1-Oxotetradecyl)-L-Lysyl-L-Threonyl-L-Threonyl-L-Lysyl- CAS NO 1392416-25-9


Bremelanotide Acetate CAS NO 1607799-13-2
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






