share

H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Oh CAS NO 136799-54-7


Unit Price:

CAS No.:136799-54-7

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Oh is a synthetic peptide sequence of significant interest in advanced biochemical research and development. This compound is valued for its precise structure, which enables its use as a critical tool in studying protein-protein interactions, enzyme mechanisms, and as a potential precursor for novel therapeutic agents. It is primarily required by biotechnology firms, pharmaceutical research laboratories, and academic institutions engaged in peptide chemistry, immunology, and drug discovery programs.

Application

  • Biochemical Research: Serves as a high-purity reference standard or substrate in enzymatic studies and interaction assays.
  • Pharmaceutical R&D: Used as a key intermediate or building block in the development of peptide-based therapeutics and diagnostic agents.
  • Immunology Studies: Potential application as an antigen or epitope for antibody production and vaccine research.
  • Proteomics & Signal Transduction: A tool for investigating specific signaling pathways and post-translational modifications.
  • Academic Research: Employed in university laboratories for teaching and fundamental research in peptide synthesis and molecular biology.
  • Custom Peptide Synthesis: Acts as a starting point or template for the custom synthesis of modified peptide analogs.

Basic Information

Product Name H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Oh
CAS No. 136799-54-7
Molecular Formula C179H295N57O55S2
Molecular Weight ~4125.7 g/mol
Synonyms SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL-OH; 36-Amino acid peptide (SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL); H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leucinol; Peptide Sequence 136799-54-7; Synthetic Polypeptide; Custom Peptide 136799-54-7
EINECS Contact for details

Quality Control

Our peptide products are manufactured and analyzed under strict quality management systems. Each batch of H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Oh undergoes rigorous analytical testing, including HPLC for purity, MS for identity confirmation, and amino acid analysis. Certificates of Analysis (COA) detailing all specifications are provided to ensure traceability and compliance with your research requirements.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below in a dry environment. This product is hygroscopic (moisture-sensitive). For long-term storage, keep desiccated. Allow the vial to equilibrate to room temperature before opening to minimize moisture absorption.

Specification

Item Specification
Appearance White to off-white powder
Identification (HPLC & MS) Conforms to reference
Purity (HPLC) ≥ 95%
Single Impurity (HPLC) ≤ 1.0%
Amino Acid Composition Within ±10% of theoretical
Peptide Content ≥ 80%
Water Content (KF) ≤ 5.0%
Acetate Content (HPIC) ≤ 10.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.