share

Amyloid β-Protein (Human, 1-40) Trifluoroacetate CAS NO 131438-79-4


Unit Price:

CAS No.:131438-79-4

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

Amyloid β-Protein (Human, 1-40) Trifluoroacetate is a synthetic peptide fragment corresponding to the first 40 amino acids of the human amyloid-beta protein, provided as a trifluoroacetate salt. This peptide is a critical research tool for studying the molecular mechanisms underlying Alzheimer's disease and other amyloid-related pathologies. It is essential for scientists and pharmaceutical developers in neuroscience research, drug discovery, and diagnostic assay development, enabling the investigation of protein aggregation, neurotoxicity, and therapeutic interventions.

Application

  • Alzheimer's Disease Research: Used as a standard for studying the aggregation kinetics, fibril formation, and neurotoxic effects of amyloid-beta peptides in vitro and in cellular models.
  • Drug Discovery & Screening: Serves as a key target substrate in high-throughput screening assays to identify and validate potential inhibitors of amyloid-beta aggregation or toxicity.
  • Biomarker & Diagnostic Development: Employed as a calibrant and reference material in the development of immunoassays (ELISA, Western Blot) and other analytical methods for detecting amyloid-beta in biological samples.
  • Structural Biology Studies: Utilized in nuclear magnetic resonance (NMR) spectroscopy, X-ray crystallography, and other techniques to elucidate the three-dimensional structure and conformational dynamics of the peptide.
  • Toxicity & Mechanism of Action Studies: Applied in primary neuronal cultures and other experimental systems to model synaptic dysfunction and cell death pathways associated with amyloidosis.
  • Antibody & Reagent Production: Acts as an immunogen for generating specific monoclonal or polyclonal antibodies against amyloid-beta epitopes.

Basic Information

Item Details
Product Name Amyloid β-Protein (Human, 1-40) Trifluoroacetate
CAS No. 131438-79-4
Molecular Formula C194H295N55O60 • xC2HF3O2
Molecular Weight 4329.8 g/mol (free peptide, average)
Synonyms Amyloid β-Protein (1-40), human; Aβ(1-40); Amyloid β-Peptide (1-40); β-Amyloid Peptide (1-40); Aβ40; Amyloid Precursor Protein (672-711); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
EINECS Contact for details

Quality Control

Our Amyloid β-Protein (Human, 1-40) Trifluoroacetate is manufactured under stringent conditions to ensure batch-to-batch consistency and high biological activity. Quality is verified through a comprehensive suite of analytical techniques, including reverse-phase HPLC, mass spectrometry (MS), and amino acid analysis. A detailed Certificate of Analysis (COA) is provided with each batch, confirming identity, purity, peptide content, and endotoxin levels suitable for cell-based assays.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake. Aliquot reconstituted solutions to avoid repeated freeze-thaw cycles.

Specification

Item Specification
Appearance White to off-white lyophilized powder
Identification (HPLC & MS) Conforms to reference standard
Purity (HPLC) ≥ 95%
Peptide Content ≥ 70% (by amino acid analysis)
Molecular Weight 4329.8 ± 2.0 Da (MALDI-TOF MS)
Solubility Soluble in water, DMSO, or dilute acetic acid
Endotoxin Level < 1.0 EU/mg

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.