

share
Amyloid β-Protein (Human, 1-40) Trifluoroacetate CAS NO 131438-79-4
Unit Price:
CAS No.:131438-79-4
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
Amyloid β-Protein (Human, 1-40) Trifluoroacetate is a synthetic peptide fragment corresponding to the first 40 amino acids of the human amyloid-beta protein, provided as a trifluoroacetate salt. This peptide is a critical research tool for studying the molecular mechanisms underlying Alzheimer's disease and other amyloid-related pathologies. It is essential for scientists and pharmaceutical developers in neuroscience research, drug discovery, and diagnostic assay development, enabling the investigation of protein aggregation, neurotoxicity, and therapeutic interventions.
Application
- Alzheimer's Disease Research: Used as a standard for studying the aggregation kinetics, fibril formation, and neurotoxic effects of amyloid-beta peptides in vitro and in cellular models.
- Drug Discovery & Screening: Serves as a key target substrate in high-throughput screening assays to identify and validate potential inhibitors of amyloid-beta aggregation or toxicity.
- Biomarker & Diagnostic Development: Employed as a calibrant and reference material in the development of immunoassays (ELISA, Western Blot) and other analytical methods for detecting amyloid-beta in biological samples.
- Structural Biology Studies: Utilized in nuclear magnetic resonance (NMR) spectroscopy, X-ray crystallography, and other techniques to elucidate the three-dimensional structure and conformational dynamics of the peptide.
- Toxicity & Mechanism of Action Studies: Applied in primary neuronal cultures and other experimental systems to model synaptic dysfunction and cell death pathways associated with amyloidosis.
- Antibody & Reagent Production: Acts as an immunogen for generating specific monoclonal or polyclonal antibodies against amyloid-beta epitopes.
Basic Information
| Item | Details |
|---|---|
| Product Name | Amyloid β-Protein (Human, 1-40) Trifluoroacetate |
| CAS No. | 131438-79-4 |
| Molecular Formula | C194H295N55O60 • xC2HF3O2 |
| Molecular Weight | 4329.8 g/mol (free peptide, average) |
| Synonyms | Amyloid β-Protein (1-40), human; Aβ(1-40); Amyloid β-Peptide (1-40); β-Amyloid Peptide (1-40); Aβ40; Amyloid Precursor Protein (672-711); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| EINECS | Contact for details |
Quality Control
Our Amyloid β-Protein (Human, 1-40) Trifluoroacetate is manufactured under stringent conditions to ensure batch-to-batch consistency and high biological activity. Quality is verified through a comprehensive suite of analytical techniques, including reverse-phase HPLC, mass spectrometry (MS), and amino acid analysis. A detailed Certificate of Analysis (COA) is provided with each batch, confirming identity, purity, peptide content, and endotoxin levels suitable for cell-based assays.
Storage
Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake. Aliquot reconstituted solutions to avoid repeated freeze-thaw cycles.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC & MS) | Conforms to reference standard |
| Purity (HPLC) | ≥ 95% |
| Peptide Content | ≥ 70% (by amino acid analysis) |
| Molecular Weight | 4329.8 ± 2.0 Da (MALDI-TOF MS) |
| Solubility | Soluble in water, DMSO, or dilute acetic acid |
| Endotoxin Level | < 1.0 EU/mg |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


L-Arginine, L-asparaginyl-L-α-glutamyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-valyl-L-prolyl-L-α-aspartyl-L-threonyl-L-lysyl-L-valyl-L-asparaginyl-L-phenylalanyl-L-tyrosyl-L-alanyl-L-tryptophyl-L-lysyl- CAS NO 915091-83-7


Acetyl Octapeptide-1 CAS NO 868844-74-0


N2-(1-Oxohexadecyl)-L-Lysyl-L-Valyl-(2S)-2,4-Diaminobutanoyl-L-Threonine Bis(Trifluoroacetate) (Salt) CAS NO 883558-32-5


Copper Tripeptide CAS NO 89030-95-5


(D-Ala2)-Leu-Enkephalin CAS NO 64963-01-5


Copper Peptide CAS NO 49557-75-7


Orexin A (17-33) CAS NO 343268-91-7


H-Lys-Cys-Asp-Ile-Cys-Thr-Asp-Glu-Tyr-Oh CAS NO 197171-78-1


H-Pro-Leu-Gly-Nh2 CAS NO 2002-44-0


Pinealon CAS NO 175175-23-2


L-Arginine, Glycyl-L-Valyl-L-Seryl-L-Tryptophylglycyl-L-Leucyl- CAS NO 1801959-12-5


Melanotan Ii CAS NO 121062-08-6


Goralatide CAS NO 127103-11-1


H-β-Ala-β-Ala-Oh CAS NO 2140-53-6


α-Msh (11-13) (Free Acid) CAS NO 67727-97-3


Nesiritide Acetate CAS NO 114471-18-0


Tachyplesin CAS NO 118231-04-2


Exendin-4 CAS NO 141758-74-9


L-Serine, N2-(1-Oxotetradecyl)-L-Lysyl-L-Threonyl-L-Threonyl-L-Lysyl- CAS NO 1392416-25-9


Bremelanotide Acetate CAS NO 1607799-13-2
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






