Description

Amyloid β-Protein (Human, 1-40) Trifluoroacetate is a synthetic peptide fragment corresponding to the first 40 amino acids of the human amyloid-beta protein, provided as a trifluoroacetate salt. This peptide is a critical research tool for studying the molecular mechanisms underlying Alzheimer's disease and other amyloid-related pathologies. It is essential for scientists and pharmaceutical developers in neuroscience research, drug discovery, and diagnostic assay development, enabling the investigation of protein aggregation, neurotoxicity, and therapeutic interventions.

Application

• Alzheimer's Disease Research: Used as a standard for studying the aggregation kinetics, fibril formation, and neurotoxic effects of amyloid-beta peptides in vitro and in cellular models.
• Drug Discovery & Screening: Serves as a key target substrate in high-throughput screening assays to identify and validate potential inhibitors of amyloid-beta aggregation or toxicity.
• Biomarker & Diagnostic Development: Employed as a calibrant and reference material in the development of immunoassays (ELISA, Western Blot) and other analytical methods for detecting amyloid-beta in biological samples.
• Structural Biology Studies: Utilized in nuclear magnetic resonance (NMR) spectroscopy, X-ray crystallography, and other techniques to elucidate the three-dimensional structure and conformational dynamics of the peptide.
• Toxicity & Mechanism of Action Studies: Applied in primary neuronal cultures and other experimental systems to model synaptic dysfunction and cell death pathways associated with amyloidosis.
• Antibody & Reagent Production: Acts as an immunogen for generating specific monoclonal or polyclonal antibodies against amyloid-beta epitopes.

Basic Information

Item	Details
Product Name	Amyloid β-Protein (Human, 1-40) Trifluoroacetate
CAS No.	131438-79-4
Molecular Formula	C194H295N55O60 • xC2HF3O2
Molecular Weight	4329.8 g/mol (free peptide, average)
Synonyms	Amyloid β-Protein (1-40), human; Aβ(1-40); Amyloid β-Peptide (1-40); β-Amyloid Peptide (1-40); Aβ40; Amyloid Precursor Protein (672-711); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
EINECS	Contact for details

Quality Control

Our Amyloid β-Protein (Human, 1-40) Trifluoroacetate is manufactured under stringent conditions to ensure batch-to-batch consistency and high biological activity. Quality is verified through a comprehensive suite of analytical techniques, including reverse-phase HPLC, mass spectrometry (MS), and amino acid analysis. A detailed Certificate of Analysis (COA) is provided with each batch, confirming identity, purity, peptide content, and endotoxin levels suitable for cell-based assays.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake. Aliquot reconstituted solutions to avoid repeated freeze-thaw cycles.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC & MS)	Conforms to reference standard
Purity (HPLC)	≥ 95%
Peptide Content	≥ 70% (by amino acid analysis)
Molecular Weight	4329.8 ± 2.0 Da (MALDI-TOF MS)
Solubility	Soluble in water, DMSO, or dilute acetic acid
Endotoxin Level	< 1.0 EU/mg

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.