Description

Exendin 3 is a synthetic peptide analog of exendin-4, a glucagon-like peptide-1 (GLP-1) receptor agonist originally isolated from the saliva of the Gila monster. This compound is a critical research tool for studying glucose metabolism, insulin secretion, and the pathophysiology of diabetes. It is primarily utilized by pharmaceutical R&D teams, academic researchers, and biotechnology companies focused on metabolic disease research and novel therapeutic development for type 2 diabetes and obesity.

Application

• Pharmacological Research: Used as a reference standard and active agent in studies investigating GLP-1 receptor signaling, mechanism of action, and downstream metabolic effects.
• Drug Discovery & Development: Serves as a lead compound or comparator in the screening and development of next-generation incretin-based therapies for diabetes and weight management.
• Biochemical Assays: Employed in in vitro binding assays, cell-based functional assays (e.g., cAMP accumulation), and receptor activation studies to validate experimental models.
• Academic & Preclinical Studies: Facilitates fundamental research into pancreatic β-cell function, appetite regulation, and the potential neuroprotective effects of GLP-1 analogs.
• Quality Control & Analytical Reference: Acts as a high-purity standard for the identification and quantification of exendin-related peptides in analytical methods like HPLC and mass spectrometry.

Basic Information

Product Name	Exendin 3
CAS No.	130391-54-7
Molecular Formula	C184H282N50O60S
Molecular Weight	4189.6 g/mol
Synonyms	Exendin-3; Helospectin II; Exendin (9-39); [Tyr39]Exendin-4; GLP-1 Receptor Antagonist; Exendin-4 analog; HSEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (Sequence); 130391-54-7
EINECS	Contact for details

Quality Control

Our Exendin 3 is manufactured under strict quality management systems to ensure batch-to-batch consistency and high purity for research applications. Each lot is characterized using advanced analytical techniques including HPLC for purity determination and mass spectrometry for identity confirmation. A comprehensive Certificate of Analysis (COA) detailing purity, peptide content, and analytical data is provided with every shipment to support your regulatory and research documentation needs.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a dry environment before opening to minimize moisture uptake. Aliquot into single-use quantities to avoid repeated freeze-thaw cycles.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC/MS)	Conforms to reference standard
Purity (HPLC)	≥ 95%
Peptide Content	≥ 80% (by weight)
Water Content (KF)	≤ 5.0%
Acetate Content (HPLC)	≤ 10.0%
Single Impurity (HPLC)	≤ 1.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.