

share
Exendin 3 CAS NO 130391-54-7
Unit Price:
CAS No.:130391-54-7
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
Exendin 3 is a synthetic peptide analog of exendin-4, a glucagon-like peptide-1 (GLP-1) receptor agonist originally isolated from the saliva of the Gila monster. This compound is a critical research tool for studying glucose metabolism, insulin secretion, and the pathophysiology of diabetes. It is primarily utilized by pharmaceutical R&D teams, academic researchers, and biotechnology companies focused on metabolic disease research and novel therapeutic development for type 2 diabetes and obesity.
Application
- Pharmacological Research: Used as a reference standard and active agent in studies investigating GLP-1 receptor signaling, mechanism of action, and downstream metabolic effects.
- Drug Discovery & Development: Serves as a lead compound or comparator in the screening and development of next-generation incretin-based therapies for diabetes and weight management.
- Biochemical Assays: Employed in in vitro binding assays, cell-based functional assays (e.g., cAMP accumulation), and receptor activation studies to validate experimental models.
- Academic & Preclinical Studies: Facilitates fundamental research into pancreatic β-cell function, appetite regulation, and the potential neuroprotective effects of GLP-1 analogs.
- Quality Control & Analytical Reference: Acts as a high-purity standard for the identification and quantification of exendin-related peptides in analytical methods like HPLC and mass spectrometry.
Basic Information
| Product Name | Exendin 3 |
| CAS No. | 130391-54-7 |
| Molecular Formula | C184H282N50O60S |
| Molecular Weight | 4189.6 g/mol |
| Synonyms | Exendin-3; Helospectin II; Exendin (9-39); [Tyr39]Exendin-4; GLP-1 Receptor Antagonist; Exendin-4 analog; HSEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (Sequence); 130391-54-7 |
| EINECS | Contact for details |
Quality Control
Our Exendin 3 is manufactured under strict quality management systems to ensure batch-to-batch consistency and high purity for research applications. Each lot is characterized using advanced analytical techniques including HPLC for purity determination and mass spectrometry for identity confirmation. A comprehensive Certificate of Analysis (COA) detailing purity, peptide content, and analytical data is provided with every shipment to support your regulatory and research documentation needs.
Storage
Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a dry environment before opening to minimize moisture uptake. Aliquot into single-use quantities to avoid repeated freeze-thaw cycles.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC/MS) | Conforms to reference standard |
| Purity (HPLC) | ≥ 95% |
| Peptide Content | ≥ 80% (by weight) |
| Water Content (KF) | ≤ 5.0% |
| Acetate Content (HPLC) | ≤ 10.0% |
| Single Impurity (HPLC) | ≤ 1.0% |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


L-Arginine, L-asparaginyl-L-α-glutamyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-valyl-L-prolyl-L-α-aspartyl-L-threonyl-L-lysyl-L-valyl-L-asparaginyl-L-phenylalanyl-L-tyrosyl-L-alanyl-L-tryptophyl-L-lysyl- CAS NO 915091-83-7


Acetyl Octapeptide-1 CAS NO 868844-74-0


N2-(1-Oxohexadecyl)-L-Lysyl-L-Valyl-(2S)-2,4-Diaminobutanoyl-L-Threonine Bis(Trifluoroacetate) (Salt) CAS NO 883558-32-5


Copper Tripeptide CAS NO 89030-95-5


(D-Ala2)-Leu-Enkephalin CAS NO 64963-01-5


Copper Peptide CAS NO 49557-75-7


Orexin A (17-33) CAS NO 343268-91-7


H-Lys-Cys-Asp-Ile-Cys-Thr-Asp-Glu-Tyr-Oh CAS NO 197171-78-1


H-Pro-Leu-Gly-Nh2 CAS NO 2002-44-0


Pinealon CAS NO 175175-23-2


L-Arginine, Glycyl-L-Valyl-L-Seryl-L-Tryptophylglycyl-L-Leucyl- CAS NO 1801959-12-5


Melanotan Ii CAS NO 121062-08-6


Goralatide CAS NO 127103-11-1


H-β-Ala-β-Ala-Oh CAS NO 2140-53-6


α-Msh (11-13) (Free Acid) CAS NO 67727-97-3


Nesiritide Acetate CAS NO 114471-18-0


Tachyplesin CAS NO 118231-04-2


Exendin-4 CAS NO 141758-74-9


L-Serine, N2-(1-Oxotetradecyl)-L-Lysyl-L-Threonyl-L-Threonyl-L-Lysyl- CAS NO 1392416-25-9


Bremelanotide Acetate CAS NO 1607799-13-2
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






