Description

H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-Nh2 is a synthetic peptide sequence of significant interest in biochemical and pharmaceutical research. This compound is valued for its role as a model substrate or potential bioactive agent in the study of enzymatic processes and signal transduction pathways. It is primarily utilized by research institutions, biotechnology companies, and pharmaceutical developers engaged in proteomics, drug discovery, and the development of diagnostic assays.

Application

• Biochemical Research: Used as a high-purity substrate for studying protease and kinase enzyme kinetics and specificity.
• Pharmaceutical Development: Serves as a reference standard or lead compound in the discovery of novel therapeutic agents targeting specific protein interactions.
• Proteomics & Cell Signaling: Employed in assays to investigate intracellular signaling cascades and post-translational modifications.
• Diagnostic Reagent Manufacturing: Acts as a key component in the development of sensitive and specific immunoassays and diagnostic kits.
• Academic Research: Provides a critical tool for universities and research labs exploring peptide structure-function relationships.
• Quality Control Standard: Used as an analytical reference material to ensure the consistency and purity of related biopharmaceutical products.

Basic Information

Product Name	H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-Nh2
CAS No.	125093-93-8
Molecular Formula	C₁₆₀H₂₇₀N₅₆O₄₀S
Molecular Weight	~3770.2 g/mol
Synonyms	KPRRPTYTDNYTRLRKQMAVKKYLNSILN-NH2; Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn Amide; H-KPRRPTYTDNYTRLRKQMAVKKYLNSILN-NH2; Synthetic Peptide 125093-93-8; KPRRPTYTDNYTRLRKQMAVKKYLNSILN-NH₂; [Lys1, Pro2, Arg3, Arg4, Pro5, Tyr6, Thr7, Asp8, Asn9, Tyr10, Thr11, Arg12, Leu13, Arg14, Lys15, Gln16, Met17, Ala18, Val19, Lys20, Lys21, Tyr22, Leu23, Asn24, Ser25, Ile26, Leu27, Asn28]-Amide
EINECS	Contact for details

Quality Control

Our peptide products are manufactured under strict quality management systems. Each batch undergoes comprehensive analytical testing, including HPLC for purity and MS for identity confirmation, to ensure they meet the high standards required for research and development. Certificates of Analysis (COA) detailing purity, peptide content, and analytical data are available upon request.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below in a dry environment. This product is hygroscopic (moisture-sensitive). For long-term storage, it is recommended to store desiccated at -20°C. Allow the vial to warm to room temperature before opening to minimize moisture absorption.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC & MS)	Conforms to reference standard
Purity (HPLC)	≥ 95%
Peptide Content	≥ 70% (by weight)
Single Impurity (HPLC)	≤ 1.0%
Water Content (KF)	≤ 8.0%
Acetate Content (HPIC)	≤ 15.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.