

share
H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-Nh2 CAS NO 125093-93-8
Unit Price:
CAS No.:125093-93-8
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-Nh2 is a synthetic peptide sequence of significant interest in biochemical and pharmaceutical research. This compound is valued for its role as a model substrate or potential bioactive agent in the study of enzymatic processes and signal transduction pathways. It is primarily utilized by research institutions, biotechnology companies, and pharmaceutical developers engaged in proteomics, drug discovery, and the development of diagnostic assays.
Application
- Biochemical Research: Used as a high-purity substrate for studying protease and kinase enzyme kinetics and specificity.
- Pharmaceutical Development: Serves as a reference standard or lead compound in the discovery of novel therapeutic agents targeting specific protein interactions.
- Proteomics & Cell Signaling: Employed in assays to investigate intracellular signaling cascades and post-translational modifications.
- Diagnostic Reagent Manufacturing: Acts as a key component in the development of sensitive and specific immunoassays and diagnostic kits.
- Academic Research: Provides a critical tool for universities and research labs exploring peptide structure-function relationships.
- Quality Control Standard: Used as an analytical reference material to ensure the consistency and purity of related biopharmaceutical products.
Basic Information
| Product Name | H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-Nh2 |
| CAS No. | 125093-93-8 |
| Molecular Formula | C₁₆₀H₂₇₀N₅₆O₄₀S |
| Molecular Weight | ~3770.2 g/mol |
| Synonyms | KPRRPTYTDNYTRLRKQMAVKKYLNSILN-NH2; Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn Amide; H-KPRRPTYTDNYTRLRKQMAVKKYLNSILN-NH2; Synthetic Peptide 125093-93-8; KPRRPTYTDNYTRLRKQMAVKKYLNSILN-NH₂; [Lys1, Pro2, Arg3, Arg4, Pro5, Tyr6, Thr7, Asp8, Asn9, Tyr10, Thr11, Arg12, Leu13, Arg14, Lys15, Gln16, Met17, Ala18, Val19, Lys20, Lys21, Tyr22, Leu23, Asn24, Ser25, Ile26, Leu27, Asn28]-Amide |
| EINECS | Contact for details |
Quality Control
Our peptide products are manufactured under strict quality management systems. Each batch undergoes comprehensive analytical testing, including HPLC for purity and MS for identity confirmation, to ensure they meet the high standards required for research and development. Certificates of Analysis (COA) detailing purity, peptide content, and analytical data are available upon request.
Storage
Preserve in a tightly closed container, protected from light. Store at -20°C or below in a dry environment. This product is hygroscopic (moisture-sensitive). For long-term storage, it is recommended to store desiccated at -20°C. Allow the vial to warm to room temperature before opening to minimize moisture absorption.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC & MS) | Conforms to reference standard |
| Purity (HPLC) | ≥ 95% |
| Peptide Content | ≥ 70% (by weight) |
| Single Impurity (HPLC) | ≤ 1.0% |
| Water Content (KF) | ≤ 8.0% |
| Acetate Content (HPIC) | ≤ 15.0% |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


L-Arginine, L-asparaginyl-L-α-glutamyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-valyl-L-prolyl-L-α-aspartyl-L-threonyl-L-lysyl-L-valyl-L-asparaginyl-L-phenylalanyl-L-tyrosyl-L-alanyl-L-tryptophyl-L-lysyl- CAS NO 915091-83-7


Acetyl Octapeptide-1 CAS NO 868844-74-0


N2-(1-Oxohexadecyl)-L-Lysyl-L-Valyl-(2S)-2,4-Diaminobutanoyl-L-Threonine Bis(Trifluoroacetate) (Salt) CAS NO 883558-32-5


Copper Tripeptide CAS NO 89030-95-5


(D-Ala2)-Leu-Enkephalin CAS NO 64963-01-5


Copper Peptide CAS NO 49557-75-7


Orexin A (17-33) CAS NO 343268-91-7


H-Lys-Cys-Asp-Ile-Cys-Thr-Asp-Glu-Tyr-Oh CAS NO 197171-78-1


H-Pro-Leu-Gly-Nh2 CAS NO 2002-44-0


Pinealon CAS NO 175175-23-2


L-Arginine, Glycyl-L-Valyl-L-Seryl-L-Tryptophylglycyl-L-Leucyl- CAS NO 1801959-12-5


Melanotan Ii CAS NO 121062-08-6


Goralatide CAS NO 127103-11-1


H-β-Ala-β-Ala-Oh CAS NO 2140-53-6


α-Msh (11-13) (Free Acid) CAS NO 67727-97-3


Nesiritide Acetate CAS NO 114471-18-0


Tachyplesin CAS NO 118231-04-2


Exendin-4 CAS NO 141758-74-9


L-Serine, N2-(1-Oxotetradecyl)-L-Lysyl-L-Threonyl-L-Threonyl-L-Lysyl- CAS NO 1392416-25-9


Bremelanotide Acetate CAS NO 1607799-13-2
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






