share

H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Ile-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser-Oh CAS NO 120796-99-8


Unit Price:

CAS No.:120796-99-8

Grade:Pharmacy Grade

Content:99.9%

Brand:Customizable

Packaging:Customizable

Description

H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Ile-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser-Oh CAS NO 120796-99-8 is a synthetic peptide sequence of significant interest in advanced biochemical research and development. This compound is valued for its specific structural motifs, including multiple cysteine residues that can form disulfide bridges, making it a critical tool for studying protein folding, stability, and molecular interactions. It is primarily utilized by research institutions and pharmaceutical companies engaged in peptide-based drug discovery, proteomics, and the development of novel therapeutic agents.

Application

  • Biochemical Research: Used as a reference standard or model compound for studying peptide structure, folding kinetics, and disulfide bond formation.
  • Pharmaceutical R&D: Serves as a key intermediate or active pharmaceutical ingredient (API) precursor in the development of peptide-based therapeutics.
  • Proteomics & Biomarker Discovery: Employed in mass spectrometry and chromatography as a calibration standard or in method development for complex peptide analysis.
  • Enzyme & Receptor Studies: Functions as a substrate or ligand in assays designed to investigate enzyme activity, receptor binding, and signal transduction pathways.
  • Vaccine Development: Potential use as a synthetic antigen or immunogenic peptide sequence in the design of novel vaccines.
  • Cosmeceutical Research: Investigated for bioactive properties in advanced skincare and cosmetic formulations targeting specific cellular pathways.

Basic Information

Product Name H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Ile-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser-Oh
CAS No. 120796-99-8
Molecular Formula C179H277N51O58S5
Molecular Weight ~4066.7 g/mol
Synonyms CAS 120796-99-8; Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Ile-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser; Synthetic 41-mer peptide; CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYLGSPSSRS; Peptide with sequence Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Ile-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser
EINECS Contact for details

Quality Control

Our peptide products are manufactured under strict quality management systems to ensure batch-to-batch consistency and high purity. Each lot undergoes comprehensive analytical testing, including HPLC for purity and MS for identity confirmation. We provide full traceability and detailed Certificates of Analysis (COA) upon request, documenting key parameters such as assay, related substances, and residual solvents to support your regulatory and research needs.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below for long-term stability. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake.

Specification

Item Specification
Appearance White to off-white lyophilized powder
Identification (MS) Conforms to structure
Purity (HPLC) ≥ 95.0%
Assay (HPLC) ≥ 97.0% (on anhydrous basis)
Water Content (KF) ≤ 5.0%
Acetate Content (HPLC) ≤ 10.0%
Single Impurity (HPLC) ≤ 1.0%
Peptide Content ≥ 80.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.

Complete Your RFQ

0/ 2000

why choose us

Trusted Manufacturer

With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.

Rigorous Quality Assurance

Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.

Advanced R&D Expertise

Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.