Description

Galanin, Human is a bioactive neuropeptide consisting of 30 amino acids, playing a crucial role in modulating neurotransmitter release and influencing various physiological processes. Its primary value lies in its utility as a critical research tool for studying neurological functions, metabolic regulation, and pain pathways. This high-purity peptide is essential for researchers and developers in the pharmaceutical, biotechnology, and life sciences sectors, particularly for applications in neuroscience research, drug discovery, and the development of diagnostic assays.

Application

• Neuroscience Research: Used as a standard or reagent in studies investigating its role as a neurotransmitter/neuromodulator in the central and peripheral nervous systems.
• Drug Discovery & Development: Serves as a reference compound for screening and developing galanin receptor agonists or antagonists for potential therapeutic applications.
• Biochemical Assays: Employed in receptor binding studies, functional cellular assays, and signal transduction pathway analysis.
• Metabolic Research: Utilized in studies exploring galanin's effects on insulin secretion, feeding behavior, and energy homeostasis.
• Pain Research: Applied in preclinical models to investigate its modulatory role in nociception and pain perception.
• Academic & Institutional Research: A fundamental reagent for basic scientific research in university and government laboratory settings.

Basic Information

Product Name	Galanin, Human
CAS No.	119418-04-1
Molecular Formula	C₁₄₇H₂₃₈N₄₄O₄₈S
Molecular Weight	3210.6 g/mol
Synonyms	Human Galanin; GAL (1-30), Human; Galanin (human); Galanin, human (30 AA); Galanin Neuropeptide; Galanin Peptide; GALP; Galanin-Like Peptide precursor; Tryptophan(2)-Galanin (human); GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
EINECS	Contact for details

Quality Control

Our Galanin, Human is manufactured under strict quality control protocols to ensure the highest standards of purity and batch-to-batch consistency, suitable for sensitive research applications. Each lot is accompanied by a comprehensive Certificate of Analysis (COA) detailing purity, identity, and peptide content. We adhere to cGMP guidelines where applicable, and our quality systems are designed to meet the rigorous demands of pharmaceutical and academic research.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below in a freezer. For long-term storage, consider keeping the product at -70°C. The product is hygroscopic (moisture-sensitive); allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC/MS)	Conforms to reference standard
Purity (HPLC)	≥ 95%
Peptide Content	≥ 80% (by weight)
Amino Acid Composition	Conforms to theoretical values (±10%)
Single Impurity (HPLC)	≤ 1.0%
Water Content (KF)	≤ 5.0%
Acetate Content (HPLC)	≤ 10.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.