Description

Amyloid β-Protein (1-39) is a synthetic peptide fragment corresponding to the N-terminal region of the human amyloid-beta protein. This compound is of critical importance in Alzheimer's disease research, serving as a key reagent for studying β-amyloid aggregation, neurotoxicity, and the development of therapeutic interventions. It is primarily needed by pharmaceutical R&D laboratories, academic research institutions, and biotechnology companies focused on neurodegenerative diseases and peptide chemistry.

Application

• Biomedical Research: Fundamental studies on the aggregation kinetics, structure, and toxicity of amyloid-beta peptides relevant to Alzheimer's disease pathology.
• Drug Discovery & Screening: Used as a target or reference standard in high-throughput assays to identify and evaluate potential inhibitors of amyloid fibril formation.
• Antibody & Diagnostic Development: Serves as an antigen for the production and characterization of antibodies used in immunoassays and diagnostic kits.
• Biophysical Studies: Employed in techniques such as NMR, CD spectroscopy, and electron microscopy to elucidate the secondary and tertiary structure of amyloid peptides.
• Cell-based Assays: Used to induce and model amyloid-beta toxicity in neuronal cell cultures to study mechanisms of cell death and neuroprotection.
• Reference Standard: Acts a high-purity calibrant or control in analytical methods like HPLC and mass spectrometry for quality control of related peptide batches.

Basic Information

Product Name	Amyloid β-Protein (1-39)
CAS No.	115427-62-8
Molecular Formula	C194H295N55O58S
Molecular Weight	4330.8 g/mol
Synonyms	Amyloid β-Protein (1-39); Aβ(1-39); Amyloid β-Peptide (1-39); β-Amyloid (1-39); Aβ1-39; Amyloid Beta (1-39) Fragment; DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
EINECS	Contact for details

Quality Control

Our Amyloid β-Protein (1-39) is manufactured under stringent conditions to ensure the highest standards of purity and batch-to-batch consistency, suitable for sensitive research applications. Each lot undergoes comprehensive analytical characterization, including reverse-phase HPLC for purity assessment and mass spectrometry (MS) for identity confirmation. Certificates of Analysis (COA) detailing purity, peptide content, and analytical data are provided with every shipment.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake. Aliquot into single-use vials after reconstitution to avoid repeated freeze-thaw cycles.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (MS)	Consistent with theoretical molecular weight
Purity (HPLC)	≥ 95%
Peptide Content	≥ 70% (by weight)
Solubility	Soluble in water or dilute acetic acid

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.