Description

H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-Nh2 is a high-purity synthetic peptide sequence, also known as Glucagon-Like Peptide-1 (7-36) amide or GLP-1 (7-36)NH2. This compound is a critical bioactive peptide with significant research and therapeutic potential, primarily due to its role as a potent insulinotropic hormone. It is essential for researchers and developers in the pharmaceutical and biotechnology sectors focused on metabolic disease research, drug discovery, and peptide-based therapeutic development. Our supply ensures consistent quality and reliability for your most demanding applications.

Application

• Pharmaceutical Research & Development: As a reference standard and active pharmaceutical ingredient (API) intermediate in the development of novel therapeutics for Type 2 diabetes and obesity.
• Biochemical Research: Used in in vitro and in vivo studies to investigate the mechanisms of insulin secretion, glucose homeostasis, and GLP-1 receptor signaling pathways.
• Drug Discovery: Serves as a lead compound or parent molecule for the design and synthesis of GLP-1 receptor agonists with improved stability and pharmacokinetic profiles.
• Diagnostic Development: Utilized in the development of immunoassays and diagnostic kits for measuring GLP-1 levels in clinical and research settings.
• Academic & Institutional Research: A key reagent for universities and research institutes studying endocrinology, metabolism, and peptide biology.
• Preclinical Studies: Employed in animal models to evaluate the efficacy and safety of potential GLP-1-based therapies.

Basic Information

Product Name	H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-Nh2
CAS No.	17034-34-3
Molecular Formula	C149H226N40O46
Molecular Weight	3297.7 g/mol
Synonyms	Glucagon-Like Peptide-1 (7-36) amide; GLP-1 (7-36)NH2; GLP-1 (7-36) amide; Incretin hormone fragment; HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 (single-letter code); H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2; GLP-1 amide (human); Insulinotropin
EINECS	Contact for details

Quality Control

Our H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-Nh2 is manufactured under strict quality systems. Each batch undergoes rigorous analytical testing to ensure identity, purity, and consistency, meeting the high standards required for pharmaceutical research. Certificates of Analysis (COA) detailing purity by HPLC, peptide content, and related substances are provided with every shipment. We support compliance with cGMP guidelines for advanced research applications.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below for long-term stability. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake. For optimal stability, store the product desiccated.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC)	Retention time corresponds to reference standard
Identification (MS)	Consistent with molecular weight
Purity (HPLC)	≥ 95.0%
Peptide Content	≥ 80.0% (by amino acid analysis)
Single Impurity (HPLC)	≤ 1.0%
Total Impurities (HPLC)	≤ 5.0%
Water Content (KF)	≤ 5.0%
Acetate Content (HPLC)	≤ 10.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.