Description

Gastric Inhibitory Polypeptide (Porcine) is a biologically active peptide hormone, also known as glucose-dependent insulinotropic polypeptide (GIP). This product is a high-purity porcine-derived form, essential for research into metabolic regulation and endocrine function. It is a critical reagent for scientists and manufacturers in the pharmaceutical and biotechnology sectors, particularly those focused on diabetes, obesity, and gastrointestinal hormone research. Its reliable quality and biological activity make it indispensable for in vitro and in vivo studies.

Application

• Biomedical Research: Fundamental studies on the role of GIP in glucose homeostasis, insulin secretion, and fat metabolism.
• Drug Discovery & Development: Used as a reference standard and target molecule in the screening and development of novel therapeutics for type 2 diabetes and metabolic disorders.
• Diagnostic Reagent Production: Serves as a key antigen or calibrator in the development of immunoassays (ELISA, RIA) for measuring GIP levels in clinical and research settings.
• Cell Culture & In Vitro Studies: Applied in cell-based assays to investigate receptor binding, signal transduction pathways, and cellular responses.
• Academic & Institutional Research: Supports physiological and pharmacological investigations in university and government research laboratories.
• Peptide Chemistry Reference: Used as a standard in analytical method development and for comparative studies in peptide synthesis and characterization.

Basic Information

Product Name	Gastric Inhibitory Polypeptide (Porcine)
CAS No.	11063-17-5
Molecular Formula	C225H366N64O69S
Molecular Weight	~4984.8 g/mol
Synonyms	Porcine GIP; Glucose-dependent Insulinotropic Polypeptide (Porcine); GIP (1-42), porcine; Gastric Inhibitory Peptide; YAAQFTGQDNSYEGVQQLERVKQKKDPWKHNITQ; Tyr-Ala-Ala-Gln-Phe-Thr-Gly-Gln-Asp-Asn-Ser-Tyr-Glu-Gly-Val-Gln-Gln-Leu-Glu-Arg-Val-Lys-Gln-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln (Porcine sequence); Gastroinhibitory Polypeptide
EINECS	Contact for details

Quality Control

Our Gastric Inhibitory Polypeptide (Porcine) is manufactured under stringent conditions to ensure the highest standards of purity and biological activity. Each batch is subjected to a comprehensive suite of analytical tests, including HPLC for purity, mass spectrometry for identity confirmation, and amino acid analysis. We provide a detailed Certificate of Analysis (COA) with every shipment, documenting all specifications and test results to support your research and regulatory requirements.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below. This product is hygroscopic (moisture-sensitive). For long-term storage, keep desiccated. Aliquot to avoid repeated freeze-thaw cycles.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC/MS)	Conforms to reference standard
Purity (HPLC)	≥ 95.0%
Peptide Content	≥ 80.0% (by weight)
Amino Acid Composition	Within ±10% of theoretical
Water Content (KF)	≤ 5.0%
Acetate Content (HPIC)	≤ 10.0%
Biological Activity	Determined by in vitro assay (Contact for details)

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.