Description

Glycine, L-α-Glutamylglycyl-L-Threonyl-L-Phenylalanyl-L-Threonyl-L-Seryl-L-α-Aspartyl-L-Valyl-L-Seryl-L-Seryl-L-Tyrosyl-L-Leucyl-L-α-Glutamylglycyl-L-Glutaminyl-L-Alanyl-L-Alanyl-L-Lysyl-L-α-Glutamyl-L-Phenylalanyl-L-Isoleucyl-L-Alanyl-L-Tryptophyl-L-Leucyl-L-Valyl-L-Arginylglycyl-L-Arginyl- is a complex, high-purity synthetic peptide of significant interest in advanced biochemical research and development. This compound matters as a precisely engineered sequence, offering a critical tool for studying protein-protein interactions, signal transduction pathways, and as a potential precursor for novel therapeutic agents. It is primarily needed by research institutions, pharmaceutical R&D departments, and biotechnology companies focused on peptide-based drug discovery and diagnostic development.

Application

• Biomedical Research: Used as a reference standard or active probe in studies of specific biological targets, enzyme substrates, or receptor ligands.
• Pharmaceutical Development: Serves as a key intermediate or lead compound in the discovery and development of novel peptide-based therapeutics.
• Diagnostic Reagent Synthesis: Employed in the design and production of specialized reagents for immunoassays and other diagnostic platforms.
• Biochemical Tool Compound: Utilized in vitro to modulate or study specific cellular pathways and mechanisms of action.
• Academic Research: Provides a defined peptide sequence for fundamental research in biochemistry, molecular biology, and structural biology.
• Peptide Library Construction: Acts as a specific sequence component in the synthesis of focused peptide libraries for screening purposes.

Basic Information

Product Name	Glycine, L-α-Glutamylglycyl-L-Threonyl-L-Phenylalanyl-L-Threonyl-L-Seryl-L-α-Aspartyl-L-Valyl-L-Seryl-L-Seryl-L-Tyrosyl-L-Leucyl-L-α-Glutamylglycyl-L-Glutaminyl-L-Alanyl-L-Alanyl-L-Lysyl-L-α-Glutamyl-L-Phenylalanyl-L-Isoleucyl-L-Alanyl-L-Tryptophyl-L-Leucyl-L-Valyl-L-Arginylglycyl-L-Arginyl-
CAS No.	1169630-82-3
Molecular Formula	Contact for details
Molecular Weight	Contact for details
Synonyms	Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg; H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-OH; 30-mer peptide; Synthetic peptide 1169630-82-3; Custom peptide sequence; Research peptide; EGTFTTSDVSSYLEGQAAKEFIAWLVGRGR (Single-letter amino acid code)
EINECS	Contact for details

Quality Control

This high-purity synthetic peptide is manufactured under controlled GMP-like conditions to ensure batch-to-batch consistency and integrity. Quality is verified through a comprehensive suite of analytical techniques including HPLC for purity assessment, mass spectrometry (MS) for identity confirmation, and amino acid analysis. Certificates of Analysis (COA) detailing purity, identity, and other critical parameters are provided with each batch to support your research and regulatory documentation needs.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below in a freezer. This product is hygroscopic (moisture-sensitive); allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake. For long-term storage, consider storing under an inert atmosphere.

Specification

Item	Specification
Appearance	White to off-white powder
Identification (MS)	Conforms
Purity (HPLC)	≥ 95%
Single Impurity (HPLC)	≤ 1.0%
Amino Acid Composition	Conforms to theoretical values
Water Content (KF)	≤ 5.0%
Peptide Content	≥ 80%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.