Description

Neuropeptide Y (Human, Rat) is a 36-amino acid peptide neurotransmitter belonging to the pancreatic polypeptide family. This compound plays a critical role in regulating numerous physiological processes, including energy homeostasis, anxiety, and cardiovascular function. It is an essential research tool for neuroscientists, pharmacologists, and biologists studying appetite regulation, stress responses, and metabolic disorders. The product is supplied with the CAS registry number 90880-35-6.

Application

• Neuroscience Research: Used as a standard or reagent in studies investigating its role as a potent orexigenic (appetite-stimulating) agent in the central nervous system.
• Pharmacological Studies: Employed in receptor binding assays and functional studies to characterize NPY receptor subtypes (Y1, Y2, Y4, Y5, Y6) and screen for potential antagonists or agonists.
• Metabolic Disorder Research: Applied in models of obesity and diabetes to understand its effects on food intake, energy expenditure, and insulin secretion.
• Cardiovascular Research: Utilized to study its vasoconstrictive properties and role in regulating blood pressure and heart rate.
• Biochemical Assay Development: Serves as a critical component in the development and validation of immunoassays (e.g., ELISA, RIA) for quantifying NPY levels in biological samples.
• Cell Culture & In Vitro Studies: Used to stimulate cellular responses in neuronal, adipocyte, or vascular smooth muscle cell cultures to study signal transduction pathways.

Basic Information

Product Name	Neuropeptide Y (Human, Rat)
CAS No.	90880-35-6
Molecular Formula	C190H287N55O57S
Molecular Weight	4251.8 g/mol
Synonyms	Neuropeptide Y; NPY; Neuropeptide Tyrosine; Pancreatic Polypeptide Y; hNPY; rNPY; YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 (Human sequence); YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2 (Rat sequence)
EINECS	Contact for details

Quality Control

Our Neuropeptide Y (Human, Rat) is produced and tested to meet the exacting standards required for life science research. Each batch undergoes rigorous analytical characterization to ensure high purity and correct sequence integrity. Certificates of Analysis (COA) are provided, detailing results for purity (HPLC), molecular weight confirmation (MS), and peptide content. We adhere to a quality management system to ensure batch-to-batch consistency and reliable performance in your assays.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake. Aliquot reconstituted solutions to avoid repeated freeze-thaw cycles.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC/MS)	Consistent with Neuropeptide Y (Human, Rat)
Purity (HPLC)	≥ 95%
Molecular Weight (MS)	4251.8 ± 2 Da
Peptide Content	≥ 70%
Solubility	Soluble in water, acetic acid, or DMSO

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.