Description

α-Cgrp (Rat) is a synthetic peptide fragment corresponding to the calcitonin gene-related peptide (CGRP) sequence specific to rats. This high-purity biochemical is essential for targeted research into neurovascular signaling pathways and pain mechanisms. It serves as a critical reference standard and active pharmaceutical ingredient (API) intermediate for neuroscientists and pharmaceutical developers working on migraine therapeutics and cardiovascular research. The compound, identified by CAS No. 83651-90-5, is supplied under stringent quality control for reliable and reproducible experimental results.

Application

• Neuroscience Research: Used as a precise biochemical tool to study the role of CGRP in pain transmission, migraine pathophysiology, and neurogenic inflammation.
• Pharmaceutical Development: Serves as a key reference standard and intermediate in the R&D of novel CGRP receptor antagonists and monoclonal antibodies for migraine prevention.
• Cardiovascular Studies: Employed in vascular biology research to investigate CGRP's vasodilatory effects and its implications for blood pressure regulation.
• Biomarker Assay Development: Utilized for the calibration and validation of immunoassays (ELISA, RIA) designed to detect and quantify CGRP levels in biological samples.
• Academic & Institutional Research: Provides a defined peptide substrate for university and contract research organization (CRO) laboratories focusing on peptide-receptor interactions.

Basic Information

Item	Detail
Product Name	α-Cgrp (Rat)
CAS No.	83651-90-5
Molecular Formula	C145H244N44O42S2
Molecular Weight	~3280.8 g/mol
Synonyms	Rat α-CGRP; α-CGRP (Rat); Calcitonin Gene-Related Peptide (Rat); CGRP-I (Rat); CGRP Fragment (Rat); SCGNLRATCMLGTYTQDFNKFHTFPQTAIGVGAP; Synthetic CGRP Peptide (Rat)
EINECS	Contact for details

Quality Control

Every batch of α-Cgrp (Rat) is manufactured and tested under a quality management system. We provide comprehensive analytical data to ensure identity, purity, and consistency, meeting the exacting standards required for preclinical research and development. A Certificate of Analysis (COA) detailing purity (by HPLC), peptide content, amino acid analysis, and mass spectrometry (MS) confirmation is supplied with each shipment.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below in a freezer. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to minimize moisture uptake. For long-term storage, consider storing under an inert atmosphere.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC & MS)	Conforms to reference standard
Purity (HPLC)	≥ 95%
Peptide Content	≥ 80% (by weight)
Amino Acid Analysis	Within ± 10% of theoretical
Water Content (KF)	≤ 5.0%
Acetate Content (HPIC)	≤ 10.0%
Single Impurity (HPLC)	≤ 1.0%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.