

share
α-Cgrp (Rat) CAS NO 83651-90-5
Unit Price:
CAS No.:83651-90-5
Grade:Pharmacy Grade
Content:99.9%
Brand:Customizable
Packaging:Customizable
Description
α-Cgrp (Rat) is a synthetic peptide fragment corresponding to the calcitonin gene-related peptide (CGRP) sequence specific to rats. This high-purity biochemical is essential for targeted research into neurovascular signaling pathways and pain mechanisms. It serves as a critical reference standard and active pharmaceutical ingredient (API) intermediate for neuroscientists and pharmaceutical developers working on migraine therapeutics and cardiovascular research. The compound, identified by CAS No. 83651-90-5, is supplied under stringent quality control for reliable and reproducible experimental results.
Application
- Neuroscience Research: Used as a precise biochemical tool to study the role of CGRP in pain transmission, migraine pathophysiology, and neurogenic inflammation.
- Pharmaceutical Development: Serves as a key reference standard and intermediate in the R&D of novel CGRP receptor antagonists and monoclonal antibodies for migraine prevention.
- Cardiovascular Studies: Employed in vascular biology research to investigate CGRP's vasodilatory effects and its implications for blood pressure regulation.
- Biomarker Assay Development: Utilized for the calibration and validation of immunoassays (ELISA, RIA) designed to detect and quantify CGRP levels in biological samples.
- Academic & Institutional Research: Provides a defined peptide substrate for university and contract research organization (CRO) laboratories focusing on peptide-receptor interactions.
Basic Information
| Item | Detail |
|---|---|
| Product Name | α-Cgrp (Rat) |
| CAS No. | 83651-90-5 |
| Molecular Formula | C145H244N44O42S2 |
| Molecular Weight | ~3280.8 g/mol |
| Synonyms | Rat α-CGRP; α-CGRP (Rat); Calcitonin Gene-Related Peptide (Rat); CGRP-I (Rat); CGRP Fragment (Rat); SCGNLRATCMLGTYTQDFNKFHTFPQTAIGVGAP; Synthetic CGRP Peptide (Rat) |
| EINECS | Contact for details |
Quality Control
Every batch of α-Cgrp (Rat) is manufactured and tested under a quality management system. We provide comprehensive analytical data to ensure identity, purity, and consistency, meeting the exacting standards required for preclinical research and development. A Certificate of Analysis (COA) detailing purity (by HPLC), peptide content, amino acid analysis, and mass spectrometry (MS) confirmation is supplied with each shipment.
Storage
Preserve in a tightly closed container, protected from light. Store at -20°C or below in a freezer. This product is hygroscopic (moisture-sensitive). Allow the vial to equilibrate to room temperature in a desiccator before opening to minimize moisture uptake. For long-term storage, consider storing under an inert atmosphere.
Specification
| Item | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification (HPLC & MS) | Conforms to reference standard |
| Purity (HPLC) | ≥ 95% |
| Peptide Content | ≥ 80% (by weight) |
| Amino Acid Analysis | Within ± 10% of theoretical |
| Water Content (KF) | ≤ 5.0% |
| Acetate Content (HPIC) | ≤ 10.0% |
| Single Impurity (HPLC) | ≤ 1.0% |
Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.
Hot Related Products


Bovine Albumin CAS NO 9048-46-8


Albumin From Chicken Egg White CAS NO 9006-59-1


Melanotan-1 CAS NO 75921-69-6


Dermorphin CAS NO 77614-16-5


Dsip CAS NO 62568-57-4


Epitalon CAS NO 307297-39-8


Humanin CAS NO 330936-69-1


H-Gly-Pro-Hyp-Oh CAS NO 2239-67-0


Lactoferrin CAS NO 146897-68-9


Ll-37 CAS NO 154947-66-7


Selank Peptide CAS NO 129954-34-3


Holo-Transferrin CAS NO 11096-37-0


Hyaluronidase CAS NO 37326-33-3


Neuropeptide S (1-10) (Human) CAS NO 904910-39-0


Doreptide CAS NO 90104-48-6


Hirsutide CAS NO 865368-30-5


Nph-Peptide CAS NO 84311-50-2


n-Acetyl-Phe-Octreotide CAS NO 83795-61-3


Ha Peptide CAS NO 92000-76-5


Transdermal Peptide CAS NO 918629-48-8
why choose us
Trusted Manufacturer
With our own production facilities, we ensure consistent quality, reliable supply, and full traceability.
Rigorous Quality Assurance
Each batch undergoes strict QC, accompanied by COA, MSDS, and full compliance with international standards.
Advanced R&D Expertise
Our in-house lab drives process innovation, new product development, and tailored synthesis solutions.






