Description

(Gln22,Asn23)-Amyloid β-Protein (1-40) CAS NO 374796-75-5 is a synthetic, site-specifically modified peptide fragment of the amyloid-beta protein, a key molecule in Alzheimer's disease research. This variant, featuring glutamine and asparagine substitutions at positions 22 and 23, is critical for studying the structural determinants of amyloid aggregation and toxicity. It is an essential biochemical tool for pharmaceutical R&D, academic laboratories, and diagnostic developers focused on neurodegenerative disease mechanisms, therapeutic target validation, and inhibitor screening.

Application

• Biomedical Research: Fundamental studies on the aggregation kinetics, structural properties, and neurotoxicity of amyloid-beta peptides.
• Drug Discovery & Screening: Used as a target substrate in high-throughput assays to identify and evaluate potential therapeutic compounds that inhibit fibril formation or disrupt pre-formed aggregates.
• Antibody & Diagnostic Development: Serves as a specific antigen for generating and characterizing antibodies, and for developing immunoassays (ELISA, Western Blot) to detect amyloid-beta variants.
• Biophysical Studies: Employed in techniques like NMR, circular dichroism (CD), and electron microscopy to elucidate the secondary and tertiary structure of amyloid peptides under various conditions.
• Cell Culture & In Vitro Models: Used to induce amyloid-related cytotoxicity in neuronal cell cultures, enabling the study of cell death pathways and protective agents.
• Reference Standard: Acts as a well-defined, high-purity standard for quantitative analysis and method validation in analytical laboratories.

Basic Information

Product Name	(Gln22,Asn23)-Amyloid β-Protein (1-40)
CAS No.	374796-75-5
Molecular Formula	C194H295N55O58S
Molecular Weight	4329.8 g/mol
Synonyms	Abeta (1-40) (Gln22, Asn23); Aβ40 (Q22, N23); Amyloid β-Protein (1-40) (Gln22,Asn23); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV (Gln22,Asn23); Amyloid β-Peptide (1-40) variant; Synthetic Amyloid-β (1-40) peptide analog; Alzheimer's Disease Research Peptide
EINECS	Contact for details

Quality Control

Every batch of (Gln22,Asn23)-Amyloid β-Protein (1-40) is manufactured and analyzed under stringent quality systems. We provide comprehensive Certificates of Analysis (COA) with each shipment, detailing purity, identity, and peptide content. Our quality assurance protocols are designed to meet the exacting standards required for research and diagnostic applications, ensuring batch-to-batch consistency and reliability for your critical experiments.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This peptide is hygroscopic (moisture-sensitive) and should be allowed to equilibrate to room temperature in a desiccator before opening to prevent condensation. Aliquot into single-use vials after reconstitution to minimize freeze-thaw cycles.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC & MS)	Conforms to reference standard
Purity (HPLC)	≥ 95%
Peptide Content	≥ 80% (by amino acid analysis)
Molecular Weight	4329.8 ± 2 Da (by mass spectrometry)
Solubility	Soluble in water, DMSO, or dilute acetic acid
Endotoxin Level	< 1.0 EU/mg

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.