Description

β-Defensin-2 (Human) (Trifluoroacetate Salt) is a synthetic antimicrobial peptide that plays a critical role in the innate immune response. This high-purity compound is essential for research and development in immunology and infectious disease. It is primarily utilized by pharmaceutical researchers, diagnostic developers, and academic institutions studying host defense mechanisms, peptide therapeutics, and inflammatory pathways.

Application

• Immunological Research: Fundamental studies on innate immunity, antimicrobial peptide (AMP) function, and epithelial defense mechanisms.
• Drug Discovery & Development: Serving as a reference standard or active pharmaceutical ingredient (API) in the development of novel anti-infective and immunomodulatory therapies.
• Diagnostic Assay Development: Use as a calibrated standard in ELISA kits and other immunoassays designed to quantify human β-defensin-2 levels in clinical samples.
• Cell Culture & In Vitro Studies: Investigation of peptide effects on bacterial growth, biofilm formation, and cytokine modulation in various cell lines.
• Biomarker Research: Correlation studies linking β-defensin-2 expression levels to specific disease states, including chronic inflammatory conditions and infections.
• Formulation Science: Stability and compatibility testing for potential topical, pulmonary, or systemic delivery formulations.

Basic Information

Product Name	β-Defensin-2 (Human) (Trifluoroacetate Salt)
CAS No.	372146-20-8
Molecular Formula	C206H317N61O64S5 • xC2HF3O2
Molecular Weight	~4332.8 g/mol (free base)
Synonyms	Human β-Defensin 2; HBD-2; DEFB4A; DEFB102; Skin-Antimicrobial Peptide 1; SAP1; BD-2; Cysteine-rich antimicrobial peptide; Antimicrobial peptide HBD-2; Trifluoroacetate salt of β-Defensin-2.
EINECS	Contact for details

Quality Control

Our β-Defensin-2 (Human) (Trifluoroacetate Salt) is manufactured under strict quality systems suitable for research and development. Each batch is characterized and tested to ensure high purity and consistent biological activity. Comprehensive analysis includes reversed-phase HPLC for purity, mass spectrometry for identity confirmation, and endotoxin testing. A detailed Certificate of Analysis (COA) is provided with every shipment, documenting all relevant specifications.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This product is hygroscopic (moisture-sensitive). Allow the vial to warm to room temperature in a desiccator before opening to prevent condensation and moisture uptake.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC/MS)	Conforms to reference standard
Purity (HPLC)	≥ 95%
Peptide Content	≥ 80% (by weight)
Amino Acid Sequence	41 amino acids (GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)
Molecular Weight	~4332.8 Da (free base), confirmed by MS
Solubility	Soluble in water or aqueous buffers
Endotoxin Level	< 1.0 EU/mg

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.