Description

(Lys22)-Amyloid β-Protein (1-40) CAS NO 302905-01-7 is a synthetic, site-specifically modified peptide fragment of the amyloid-beta protein, a key molecule in Alzheimer's disease research. This high-purity biochemical is essential for studying the molecular mechanisms of amyloid aggregation, toxicity, and the development of potential therapeutic interventions. It is primarily utilized by research institutions, pharmaceutical R&D departments, and diagnostic developers focused on neurodegenerative diseases.

Application

• Biomedical Research: Fundamental studies on the aggregation kinetics, structural properties, and neurotoxic effects of amyloid-beta peptides.
• Drug Discovery & Screening: Serving as a critical target or reagent in high-throughput assays to identify and validate novel inhibitors of amyloid fibril formation.
• Antibody & Diagnostic Development: Used as an antigen for the production and characterization of specific antibodies, or as a standard in immunoassays and diagnostic kits.
• Biophysical Studies: Employed in techniques like NMR, circular dichroism (CD), and electron microscopy to elucidate the peptide's conformation and interaction with other molecules.
• Cell Culture & In Vitro Models: Application in neuronal cell culture systems to model amyloid-induced cytotoxicity and study cellular pathways.

Basic Information

Product Name	(Lys22)-Amyloid β-Protein (1-40)
CAS No.	302905-01-7
Molecular Formula	C194H295N55O58S
Molecular Weight	4329.8 g/mol
Synonyms	Abeta (1-40) Lys22; Aβ1-40 (Lys22); Amyloid β-Protein (1-40) (Lys22); DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV (Lys22); Amyloid β-Peptide (1-40) with Lysine at position 22; Lys22-Aβ40; Aβ40 (K22); Research Peptide Fragment 1-40 (Lys22)
EINECS	Contact for details

Quality Control

Our (Lys22)-Amyloid β-Protein (1-40) is manufactured under stringent conditions to ensure batch-to-batch consistency and high biological activity. Each lot is subjected to comprehensive analytical characterization, including HPLC for purity assessment and Mass Spectrometry (MS) for identity confirmation. Certificates of Analysis (COA) detailing purity, peptide content, and analytical data are provided with every shipment to support your research compliance and documentation needs.

Storage

Preserve in a tightly closed container, protected from light. For long-term stability, store desiccated at -20°C or below. This peptide is hygroscopic (moisture-sensitive) and should be allowed to equilibrate to room temperature in a desiccator before opening to prevent condensation. Aliquot into single-use vials to minimize freeze-thaw cycles and exposure to atmospheric oxygen.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (MS)	Consistent with theoretical molecular weight
Purity (HPLC)	≥ 95%
Peptide Content	≥ 70% (by weight)
Solubility	Soluble in water or dilute aqueous acetic acid
Single-Chain Integrity	Pass (by analytical HPLC/MS)

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.