Description

H-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Oh CAS NO 247902-18-7 is a synthetic peptide sequence of significant interest in advanced biochemical research and development. This compound is valued for its high purity and defined structure, which are critical for reliable and reproducible experimental results. It is primarily utilized by researchers and developers in the pharmaceutical and biotechnology sectors, particularly for applications in drug discovery, proteomics, and as a reference standard in analytical method development.

Application

• Biochemical Research: Used as a key reagent in studying protein-protein interactions, enzyme kinetics, and signal transduction pathways.
• Pharmaceutical Development: Serves as a reference standard or an intermediate in the discovery and synthesis of novel peptide-based therapeutics.
• Proteomics & Biomarker Discovery: Employed in mass spectrometry and chromatography as a calibration standard or for method validation in complex sample analysis.
• Antibody Production & Epitope Mapping: Acts as a specific antigen for generating and characterizing antibodies in immunology research.
• Cell Culture & In Vitro Studies: Utilized in cell-based assays to investigate biological activity and cellular responses.
• Quality Control & Analytical Standards: Provides a high-purity benchmark for ensuring the accuracy and consistency of analytical instruments and procedures in QC laboratories.

Basic Information

Product Name	H-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Oh
CAS No.	247902-18-7
Molecular Formula	C173H277N55O52S2
Molecular Weight	4035.5 g/mol (theoretical)
Synonyms	VSQIHMNLGKHLNSMERVEWLRKKLQDVHNF-OH; Peptide V-40; H-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH; 40-mer Peptide; VSQIHMNLGKHLNSMERVEWLRKKLQDVHNF Peptide; Synthetic Polypeptide 247902-18-7; Custom Sequence Peptide
EINECS	Contact for details

Quality Control

Our products undergo rigorous quality testing to ensure compliance with industry standards. Every batch is characterized using advanced analytical techniques to guarantee identity, purity, and consistency. Certificates of Analysis (COA) detailing specific test results, including purity by HPLC, mass spectrometry confirmation, and amino acid analysis, are available upon request. We adhere to stringent quality management protocols suitable for research and development applications.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below for long-term stability. This product is hygroscopic (moisture-sensitive); allow the vial to equilibrate to room temperature in a desiccator before opening to prevent condensation and moisture uptake. For short-term use, store desiccated at 2-8°C.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (MS)	Consistent with theoretical molecular weight
Purity (HPLC)	≥ 95%
Single Impurity (HPLC)	≤ 1.0%
Amino Acid Composition	Within ±10% of theoretical
Water Content (KF)	≤ 5.0%
Peptide Content	≥ 80%

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.