Description

Glp-2 (Human) is a synthetic 33-amino acid peptide hormone, identical to the naturally occurring human glucagon-like peptide-2. This compound is a critical research tool and active pharmaceutical ingredient (API) for investigating and developing treatments for intestinal disorders. It is primarily utilized by pharmaceutical R&D teams, biotechnology companies, and academic research institutions focused on gastroenterology, metabolic diseases, and peptide therapeutics. Its role in promoting intestinal mucosal growth makes it a key molecule for advancing therapeutic strategies.

Application

• Pharmaceutical Research & Development (R&D): Serves as a reference standard and active ingredient in preclinical and clinical studies for gastrointestinal therapies.
• Biotechnology Manufacturing: Used as a high-purity Active Pharmaceutical Ingredient (API) in the formulation of investigational drugs targeting short bowel syndrome (SBS) and other malabsorption conditions.
• Academic & Clinical Research: Essential for studying the mechanisms of intestinal adaptation, nutrient absorption, and crypt cell proliferation in laboratory settings.
• Metabolic Disorder Studies: Investigated for its potential role in managing conditions related to gut barrier function and metabolic health.
• Peptide Therapeutic Development: Acts as a lead compound for developing analogs with enhanced stability, potency, or modified pharmacokinetic profiles.
• Cell Culture & In Vitro Assays: Used to stimulate growth and repair in intestinal cell lines for mechanistic studies.

Basic Information

Product Name	Glp-2 (Human)
CAS No.	223460-79-5
Molecular Formula	C149H248N44O55
Molecular Weight	~3763.9 g/mol
Synonyms	Glucagon-Like Peptide 2 (Human); GLP-2, human; Teduglutide (drug substance); HADGSFSDEMNTILDNLAARDFINWLIQTKITD; [Gly2]GLP-2; GLP-2 (1-33); Glucagon-like peptide 2 (1-33); INN: Teduglutide
EINECS	Contact for details

Quality Control

Our Glp-2 (Human) is manufactured under strict quality management systems. Each batch undergoes comprehensive analytical testing, including HPLC for purity and identity, mass spectrometry (MS) for confirmation, and rigorous tests for residual solvents and endotoxins. We provide Certificates of Analysis (COA) with full traceability, ensuring compliance with relevant guidelines for peptide APIs. Specifications are designed to meet the stringent requirements of pharmaceutical research and development.

Storage

Preserve in a tightly closed container, protected from light. Store at -20°C or below in a dedicated freezer. For long-term storage, consider lyophilized powder under inert atmosphere. The product is hygroscopic (moisture-sensitive); allow the vial to equilibrate to room temperature in a dry environment before opening to prevent condensation.

Specification

Item	Specification
Appearance	White to off-white lyophilized powder
Identification (HPLC)	Retention time corresponds to reference standard
Identification (MS)	Molecular weight confirmed
Purity (HPLC)	≥ 98.0%
Peptide Content	≥ 80.0% (by amino acid analysis)
Water Content (KF)	≤ 5.0%
Acetate Content (HPLC)	≤ 10.0%
Single Impurity (HPLC)	≤ 1.0%
Total Impurities (HPLC)	≤ 2.0%
Bacterial Endotoxins	< 1.0 EU/mg

Note: Specifications can be tailored. Please contact us for the detailed technical data sheet of a specific grade.